DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and rasd1

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_956826.1 Gene:rasd1 ZFINID:ZDB-GENE-040426-1473 Length:265 Species:Danio rerio

Alignment Length:259 Identity:133/260 (51%)
Similarity:178/260 (68%) Gaps:20/260 (8%)


  Fly   163 AKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPF 227
            ||||||:|:|||::.||::||:|||..||||.||||||:||||||.|:.:|:|||||||||.|||
Zfish    16 AKNCYRMVILGSTKVGKTAIVSRFLNGRFEEQYTPTIEDFHRKLYSIKGDVYQLDILDTSGNHPF 80

  Fly   228 PAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGN 292
            |||||||.||||:||||||:|:||||.||.||::.|.|||....|     |.|....:|:::.||
Zfish    81 PAMRRLSILTGDVFILVFSLDNRESFHEVQRLKQQIYETKSCLKN-----KTKENVDVPLVICGN 140

  Fly   293 KCDRDF-KTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRLV 356
            |.||:| :.||.||:...|||.:.|..| |.||::|..:|.:|..|||::.||.||:|:.||: |
Zfish   141 KGDREFYREVQRDEIEQLIAGDEQCAYF-EISAKRNTNVDQMFQRLFTLAKLPNEMSPDLHRK-V 203

  Fly   357 SVFGAPSPLPPHGSAVGGTKKNALSIKRRFSDACGVVTPNARRPSIRTDLNLMRSKTMALNEGE 420
            ||        .:...:  .||:..:.|.:..||.|:|.|.|||||:.:||..::.|  |:..|:
Zfish   204 SV--------QYCDIL--HKKSLKNKKVKDGDAYGIVAPFARRPSVHSDLMYIKEK--AIGGGQ 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 129/256 (50%)
RAS 167..338 CDD:214541 99/172 (58%)
rasd1NP_956826.1 small_GTPase 18..190 CDD:197466 103/178 (58%)
Rhes_like 20..265 CDD:133343 129/256 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BHJJ
Hieranoid 1 1.000
Homologene 1 1.000 H7509
Inparanoid 1 1.050 237 1.000 Inparanoid score I3273
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 1 1.000 FOG0002840
OrthoInspector 1 1.000 T1054014
orthoMCL 1 0.900 OOG5_139092
Panther 1 1.100 LDO PTHR46149
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5615
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.