DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8641 and CG8519

DIOPT Version :10

Sequence 1:NP_648073.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster


Alignment Length:174 Identity:43/174 - (24%)
Similarity:74/174 - (42%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 RLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDT--SGYHPFPAM 230
            ::.::|:...|||:::.|||..|:...|....|..::....:..|....:||||  .....:|..
  Fly    17 KIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYPNA 81

  Fly   231 RRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD 295
            ..| ....|..:||:|:..|:||..:.|.:.::..                  ..|:.|..||.|
  Fly    82 AEL-VQWADGLLLVYSITDRKSFNYIRRAKSDLQS------------------DTPVQLCANKVD 127

  Fly   296 R-DFKTVQVDEVMGYIAGQDNCCTFVECSARQNY-RIDDLFHSL 337
            . ..:.|..||  |.|..:|..|.|.|.||..:. ::.::|:.|
  Fly   128 MVHLRQVSRDE--GEILAKDFECKFSEVSAADHVDQVAEVFNEL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8641NP_648073.1 Rhes_like 167..434 CDD:133343 43/174 (25%)
CG8519NP_648054.2 P-loop containing Nucleoside Triphosphate Hydrolases 17..173 CDD:476819 43/174 (25%)

Return to query results.
Submit another query.