DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and Ras64B

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_523917.2 Gene:Ras64B FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster

Alignment Length:185 Identity:58/186 (31%)
Similarity:96/186 (52%) Gaps:22/186 (12%)


  Fly   167 YRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMR 231
            |:||::|....|||:|..:|:.:.|...|.||||:.:.|...|.:...:||||||:|...|.|||
  Fly     6 YKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMR 70

  Fly   232 RLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD- 295
            .....:|:.|:|||:::...||:|:.:.:..||             :.|...:.||::.||||| 
  Fly    71 EQYMRSGEGFLLVFALNDHSSFDEIPKFQRQIL-------------RVKDRDEFPMLMVGNKCDL 122

  Fly   296 RDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSL------FTVSNLP 344
            :..:.|.::|...  ..::....::||||:....:|..||.|      |.::..|
  Fly   123 KHQQQVSLEEAQN--TSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERP 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 58/186 (31%)
RAS 167..338 CDD:214541 56/178 (31%)
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 56/176 (32%)
RAS 18..169 CDD:214541 51/166 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120122074
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.