DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and Ric

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001163165.1 Gene:Ric FlyBaseID:FBgn0265605 Length:264 Species:Drosophila melanogaster

Alignment Length:171 Identity:55/172 (32%)
Similarity:87/172 (51%) Gaps:14/172 (8%)


  Fly   167 YRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMR 231
            |::|:||....|||::..:|:.:.|.:.:.||||:.:::...|.||...||||||:|...|.|||
  Fly    60 YKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVIDNEAALLDILDTAGQVEFTAMR 124

  Fly   232 RLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCDR 296
            ......|:.||:.:|:..|.||:|....|:.|...:.:             ..||::|..||.|.
  Fly   125 DQYMRCGEGFIICYSVTDRHSFQEASEYRKLITRVRLS-------------EDIPLVLIANKVDL 176

  Fly   297 DFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSL 337
            :.:.....|....:|.|.. |.|.|.||...:.||:.|::|
  Fly   177 ESQRRVTTEEGRNLANQFG-CPFFETSAALRHYIDEAFYTL 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 55/172 (32%)
RAS 167..338 CDD:214541 55/172 (32%)
RicNP_001163165.1 Rit_Rin_Ric 58..229 CDD:206712 55/172 (32%)
small_GTPase 58..223 CDD:197466 55/172 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120122099
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.