| Sequence 1: | NP_001261494.1 | Gene: | CG8641 / 38771 | FlyBaseID: | FBgn0035733 | Length: | 434 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001162628.1 | Gene: | CG13375 / 30976 | FlyBaseID: | FBgn0040370 | Length: | 306 | Species: | Drosophila melanogaster | 
| Alignment Length: | 260 | Identity: | 83/260 - (31%) | 
|---|---|---|---|
| Similarity: | 121/260 - (46%) | Gaps: | 48/260 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly   157 DDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDT 221 
  Fly   222 SGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIP 286 
  Fly   287 MILAGNKCD--RDFKT------------VQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSL 337 
  Fly   338 FTVSNLPLEMTPNHHRRLVSV---FGAPSPLPP--------HGSAVGGTKKNALSIKRRFSDACG 391 
  Fly   392  391  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG8641 | NP_001261494.1 | Rhes_like | 167..434 | CDD:133343 | 80/250 (32%) | 
| RAS | 167..338 | CDD:214541 | 65/184 (35%) | ||
| CG13375 | NP_001162628.1 | RAS | 48..215 | CDD:214541 | 66/189 (35%) | 
| Ras_dva | 49..239 | CDD:206714 | 71/212 (33%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45453054 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0395 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S1908 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D108151at50557 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.700 | |||||