DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and CG13375

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001162628.1 Gene:CG13375 FlyBaseID:FBgn0040370 Length:306 Species:Drosophila melanogaster

Alignment Length:260 Identity:83/261 (32%)
Similarity:121/261 (46%) Gaps:48/261 (18%)


  Fly   157 DDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDT 221
            ||::..|...:::|::||::.||:||:.:||.|.|...|..||||.|:..:.|......||||||
  Fly    38 DDAIGPANARHKIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDT 102

  Fly   222 SGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIP 286
            :|.:.|||||.||..:.|.||||:.:....:||||..:|:.|.||             |:...:|
  Fly   103 AGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIHET-------------KATTAVP 154

  Fly   287 MILAGNKCD--RDFKT------------VQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSL 337
            :::.|||.|  .|.:|            |.||...|          |||.||..|..|..:|..|
  Fly   155 IVVVGNKIDLLADGETEREVEYATTESVVTVDWENG----------FVEASASSNENITQVFKEL 209

  Fly   338 FTVSNLPLEMTPNHHRRLVSV---FGAPSPLPP--------HGSAVGGTKKNALSIKRRFSDACG 391
            ...:.:...::|...||..|:   .|...|..|        |.::.|||..:..|.....|.:.|
  Fly   210 LAQAKITYNLSPALRRRRQSLPQQIGNNGPSTPLHHHQHTQHHNSGGGTSASTSSAAAAASSSGG 274

  Fly   392  391
              Fly   275  274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 80/251 (32%)
RAS 167..338 CDD:214541 66/185 (36%)
CG13375NP_001162628.1 RAS 48..215 CDD:214541 66/190 (35%)
Ras_dva 49..239 CDD:206714 71/213 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120122179
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1908
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.