DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and ssr-2

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_508490.3 Gene:ssr-2 WormBaseID:WBGene00006055 Length:320 Species:Caenorhabditis elegans

Alignment Length:190 Identity:64/191 (34%)
Similarity:104/191 (54%) Gaps:21/191 (11%)


  Fly   155 LCDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDIL 219
            :|::.       ||||:|||::.||::|:.|:|.|.|...|..|||:.|.:.:||:.....||||
 Worm     1 MCEER-------YRLVVLGSAKVGKTNIIRRYLYNEFSSKYKETIEDLHSREFRIQGVPLPLDIL 58

  Fly   220 DTSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPK 284
            ||:  ..||.|||||..:...|:||||:|...||:|:..:.:.|..            ::..|.:
 Worm    59 DTN--FNFPDMRRLSIASASAFLLVFSVDDVTSFKEMSDIWQEICS------------RRSDLNE 109

  Fly   285 IPMILAGNKCDRDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSLFTVSNLP 344
            :|:::.|||||.:.|.:..:....:.....:...::|.||:.|.||.|:|.:|..:|..|
 Worm   110 LPIVVVGNKCDVENKKIYEETAKAFTNRLSSDVRYIEVSAKDNIRITDVFRTLLELSGFP 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 63/179 (35%)
RAS 167..338 CDD:214541 61/171 (36%)
ssr-2NP_508490.3 small_GTPase 6..163 CDD:197466 61/171 (36%)
P-loop_NTPase 7..163 CDD:304359 60/170 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140903229
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398885at2759
OrthoFinder 1 1.000 FOG0002840
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.