DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and rsef-1

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_508523.1 Gene:rsef-1 WormBaseID:WBGene00016344 Length:656 Species:Caenorhabditis elegans

Alignment Length:347 Identity:87/348 (25%)
Similarity:134/348 (39%) Gaps:84/348 (24%)


  Fly    14 NNNYVDVALSEAPPIHPSAATTTTPNSRNFSASNNNNVRSNSSKSNQQTAAHRGATTHPTQIPHT 78
            |.:..|...|.|..:......|.:|   ...:||.|:|.:..:.:|    ..|....|..     
 Worm   361 NESLRDALDSRASVLRQFNLRTPSP---GLLSSNRNSVENFQTSTN----VFRSVPLHAI----- 413

  Fly    79 HHPSTTHSTDEASPPQAHVVTFLDESTAGGSNGAVTSSRLVTTAELHQAHMLEHHSNLDAIEQAD 143
                   ||:|    |..:...::|.|:           |:    |..||.|:   .||.     
 Worm   414 -------STEE----QGTIFGTIEEKTS-----------LI----LDDAHSLQ---GLDT----- 444

  Fly   144 DFIYGPGAGLSLCDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTI-EEFHRKLY 207
                 ||..:.|.|.:.| |:..:|:||.|.:..||||.|.|.:..:|......|: .:||.|..
 Worm   445 -----PGDLMGLNDANGP-AERTFRIVMCGDAAVGKSSFVMRVIRRQFTNQLPSTLGVDFHVKTV 503

  Fly   208 RIRNEVFQLDILDTSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALN 272
            .:......|.:.||:|...|.::.:..|...|..|||:.:.:.:||   :|:|:.| ||      
 Worm   504 NVDGRNVALQLWDTAGQERFRSLCKSYFRRADGAILVYDVCAEQSF---LRVRDWI-ET------ 558

  Fly   273 PGSGFKKKSLPKIPMILAGNKCDRDFKTVQVDEVMGYIAGQDNC-------CTFVECSARQNYRI 330
                .|:.:...||:||.|||.|....|      .|.:|..|..       ..|:|.||.....|
 Worm   559 ----IKESTERSIPIILVGNKVDMRIST------PGSVAKTDGASMAAAMGVLFMETSALDGSNI 613

  Fly   331 DD----LFHSLFTVSNLPLEMT 348
            |:    |...|..|.::.:..|
 Worm   614 DNAMLALTRELMAVEDVEIRST 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 55/195 (28%)
RAS 167..338 CDD:214541 53/183 (29%)
rsef-1NP_508523.1 EFh 5..63 CDD:298682
EF-hand_7 6..62 CDD:290234
DUF4200 171..259 CDD:290574
Apolipoprotein 194..377 CDD:279749 4/16 (25%)
RILP-like <213..312 CDD:304877
Rab 462..622 CDD:206640 52/180 (29%)
Ras 463..625 CDD:278499 53/182 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.