powered by:
                   
 
    
    
             
          
            Protein Alignment CG8641 and Rheb
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001261494.1 | Gene: | CG8641 / 38771 | FlyBaseID: | FBgn0035733 | Length: | 434 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_730950.2 | Gene: | Rheb / 117332 | FlyBaseID: | FBgn0041191 | Length: | 182 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 173 | Identity: | 53/173 - (30%) | 
          
            | Similarity: | 92/173 -  (53%) | Gaps: | 22/173 - (12%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly   169 LVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSG---YHPFPAM 230:.|:|....||||:..:|:..:|.::|.||||....|:.|::::.:.:.::||:|   |..||..
 Fly     8 IAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQ 72
 
 
  Fly   231 RRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD 295..:.:   ..::||:|:.|::|||.|..:.|.:|:.          ..||   .:|::|.|||.|
 Fly    73 YSMDY---HGYVLVYSITSQKSFEVVKIIYEKLLDV----------MGKK---YVPVVLVGNKID 121
 
 
  Fly   296 -RDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSL 337...:||..:|  |....:.....|:|.||:||..:.|:||.|
 Fly   122 LHQERTVSTEE--GKKLAESWRAAFLETSAKQNESVGDIFHQL 162
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45453053 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E2759_KOG0395 | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 3 | 2.740 |  | 
        
      
           
             Return to query results.
             Submit another query.