DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8641 and si:dkey-27j5.5

Sequence 1:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_001345197.3 Gene:si:dkey-27j5.5 ZFINID:ZDB-GENE-121214-264 Length:387 Species:Danio rerio

Alignment Length:426 Identity:142/427 (33%)
Similarity:197/427 (46%) Gaps:79/427 (19%)


  Fly    16 NYVDVALSEAPPI------HPSAAT---TTTPNSRNFSASNNNNVRSNSS--KSNQQTAAHRG-- 67
            |...:.||...|:      |.:.|.   |:||:.  ..|..|...|..:|  |.:..:.|..|  
Zfish    14 NIKQICLSSMCPVMDQVMQHQTRALPGGTSTPSV--LLAYKNATQRLGASGFKVSALSKAGMGIL 76

  Fly    68 --ATTHPTQIPHTHHPSTTHSTDEASPPQAHVVTFLDESTAGGSNGAVTSSRLVTTAELHQAHML 130
              |||...|...........|..:|.||       :|:           .|.|...|.|    :|
Zfish    77 KLATTQLKQQEKKARVVRASSQGKAHPP-------IDK-----------KSPLDQLAAL----VL 119

  Fly   131 EHHSNLDAIEQADDFIYGPGAGLSLCDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAY 195
            ..|:.|..|..               :......:||.|:|:||:.|.||:||:.|||.:.|||.|
Zfish   120 HGHARLQPIAH---------------ESHATKPQNCRRIVVLGAPRVGKTSILRRFLRDGFEEQY 169

  Fly   196 TPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLR 260
            .||.|:||||||:||.|.:|:||||.||...|||.||||.||||:|:||||:|.|.|||||..|.
Zfish   170 EPTCEDFHRKLYQIRGETYQIDILDASGERSFPAKRRLSILTGDIFLLVFSLDDRSSFEEVRALH 234

  Fly   261 ENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD--RDFKTVQVDEVMGYIAGQDNCCTFVECS 323
            ..|:..| |||.     :.|....:|.::..||.|  .:.:.|...||:..:.   :.|...|.|
Zfish   235 TEIVAAK-AALR-----RSKQPLCVPTVVCANKVDLPAEQRAVSRPEVLSALG---SSCALFETS 290

  Fly   324 ARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRLVSVFGAPSPLPPHGSAVGGTKKNALSIKRRFSD 388
            |:.:..::.:|.:|.....||||..|:.||: ||: .:...|.....|..|:|..|...      
Zfish   291 AKDSVNLEQVFEALAQRGGLPLETGPSQHRK-VSI-RSYQALRAARQAEKGSKAPACEA------ 347

  Fly   389 ACGVVTPNARRPSIRTDLNLM------RSKTMALNE 418
            .||.:.|.|||||..|||.|:      |.::.||::
Zfish   348 PCGALYPLARRPSFGTDLRLVLGPKGNRKQSKALDK 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 107/261 (41%)
RAS 167..338 CDD:214541 78/173 (45%)
si:dkey-27j5.5XP_001345197.3 small_GTPase 139..304 CDD:197466 79/174 (45%)
P-loop_NTPase 141..387 CDD:304359 107/261 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46149
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.