| Sequence 1: | NP_001261494.1 | Gene: | CG8641 / 38771 | FlyBaseID: | FBgn0035733 | Length: | 434 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001345197.3 | Gene: | si:dkey-27j5.5 / 100006464 | ZFINID: | ZDB-GENE-121214-264 | Length: | 387 | Species: | Danio rerio | 
| Alignment Length: | 426 | Identity: | 142/426 - (33%) | 
|---|---|---|---|
| Similarity: | 197/426 - (46%) | Gaps: | 79/426 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    16 NYVDVALSEAPPI------HPSAAT---TTTPNSRNFSASNNNNVRSNSS--KSNQQTAAHRG-- 67 
  Fly    68 --ATTHPTQIPHTHHPSTTHSTDEASPPQAHVVTFLDESTAGGSNGAVTSSRLVTTAELHQAHML 130 
  Fly   131 EHHSNLDAIEQADDFIYGPGAGLSLCDDSLPSAKNCYRLVMLGSSRAGKSSIVARFLGNRFEEAY 195 
  Fly   196 TPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMRRLSFLTGDLFILVFSMDSRESFEEVVRLR 260 
  Fly   261 ENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD--RDFKTVQVDEVMGYIAGQDNCCTFVECS 323 
  Fly   324 ARQNYRIDDLFHSLFTVSNLPLEMTPNHHRRLVSVFGAPSPLPPHGSAVGGTKKNALSIKRRFSD 388 
  Fly   389 ACGVVTPNARRPSIRTDLNLM------RSKTMALNE 418 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG8641 | NP_001261494.1 | Rhes_like | 167..434 | CDD:133343 | 107/260 (41%) | 
| RAS | 167..338 | CDD:214541 | 77/172 (45%) | ||
| si:dkey-27j5.5 | XP_001345197.3 | small_GTPase | 139..304 | CDD:197466 | 79/173 (46%) | 
| P-loop_NTPase | 141..387 | CDD:304359 | 107/260 (41%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0395 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR46149 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||