DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10064 and CG9945

Sequence 1:NP_648065.1 Gene:CG10064 FlyBaseID:FBgn0035724 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_611494.1 Gene:CG9945 FlyBaseID:FBgn0034527 Length:511 Species:Drosophila melanogaster

Alignment Length:459 Identity:84/460 (18%)
Similarity:143/460 (31%) Gaps:139/460 (30%)


  Fly   291 DIELVEERTDVPLINF--------RDYPGPTWPYLRTLKKTHVSGRISSFVRSKTDMFYICTDTN 347
            |.:..:......:|||        .||.....|.:|        |:.......||||:.....::
  Fly    16 DFDSSDNELGFNVINFTVNAMDLRSDYCSSEMPVIR--------GKPDLVKFQKTDMYKEIQASS 72

  Fly   348 EIYGLNIKTWVLKLLRTCHTK-----SVYCITFPKN---YSGVFATSGKECIRIWSSGRKQELLR 404
            .:.......|  .|:.....:     |.:..:|.||   |........|:..|:.|...|     
  Fly    73 GLVSNPNNRW--NLVHALQQRENGLASPHSASFSKNQQRYISNLYIPNKKATRLMSLESK----- 130

  Fly   405 IMVYNFNCACVRFTHDGTSIVSVWNDGIIRAFTPITG---------------------------- 441
            |.|..||       ..|:.:::...||.:|.:....|                            
  Fly   131 IFVTKFN-------RSGSKLLTACQDGFVRIYDGAKGTYHLLNRIRARDVEWSIIDADFSPNGEH 188

  Fly   442 -------RLIYAIP----------------NAHNKGCSALAVASSGRLIVTGGIEGQVRVWKIDP 483
                   |.::.:|                .:|.....:|..:.:|..|:.|.....|.|..|  
  Fly   189 FAYSTWSRSLFIMPVNGGEDDCQWIDVNGLPSHRLAIFSLRYSPTGDKIIGGSNNSTVIVTDI-- 251

  Fly   484 YRQDLVGVLKDHSGPITSLDINYL----DTE---VISACTDGSCVIWDIKRMTRKQVVTANTQFM 541
             |.....:|:.|..|  ..|:|.:    |.:   :|:.|.||...::|::...|.:.::.:....
  Fly   252 -RTRNTQILRTHRMP--GKDVNSVCFLHDKDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASF 313

  Fly   542 SASYFPTGVQVITCGSDGRIIYWMVYNGALIRELTASKKSSVNCLAINETGDYFITVGSDLQV-- 604
            ...|  .|:..|...:||   |.::.|         ||..|:....|.:..:......|..||  
  Fly   314 IGHY--DGITYIDSRNDG---YHVLSN---------SKDQSIKIWDIRQPSNMRNRSRSRQQVDP 364

  Fly   605 KLWDY------------------NSGAVVGIGSEHASSVISCAYSPC----MTMFVTGSTDGSLI 647
            ..|||                  :|..:...|.....:::...:||.    .....||...|.:|
  Fly   365 TTWDYRWNRVPREFYNPHKPLEGDSSIMTYRGHRVTKTLLRAKFSPMEQTGQRYIYTGCATGRII 429

  Fly   648 IWDV 651
            |:||
  Fly   430 IYDV 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10064NP_648065.1 WD40 <25..188 CDD:295369
WD40 33..434 CDD:225201 31/159 (19%)
WD40 repeat 65..106 CDD:293791
WD40 repeat 111..151 CDD:293791
WD40 repeat 159..186 CDD:293791
WD40 280..652 CDD:225201 84/460 (18%)
WD40 366..650 CDD:238121 67/374 (18%)
WD40 repeat 370..407 CDD:293791 9/40 (23%)
WD40 repeat 412..449 CDD:293791 7/88 (8%)
WD40 repeat 456..494 CDD:293791 9/38 (24%)
WD40 repeat 499..535 CDD:293791 9/43 (21%)
WD40 repeat 541..576 CDD:293791 7/35 (20%)
WD40 repeat 583..617 CDD:293791 8/54 (15%)
WD40 repeat 625..651 CDD:293791 8/30 (27%)
CG9945NP_611494.1 WD40 128..467 CDD:295369 61/338 (18%)
WD40 repeat 131..170 CDD:293791 9/46 (20%)
WD40 <133..478 CDD:225201 59/328 (18%)
WD40 repeat 178..220 CDD:293791 2/42 (5%)
WD40 repeat 225..260 CDD:293791 9/38 (24%)
WD40 repeat 270..314 CDD:293791 8/44 (18%)
WD40 repeat 323..395 CDD:293791 16/84 (19%)
WD40 repeat 403..443 CDD:293791 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0266
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.