DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sgl and UGD2

Sequence 1:NP_476980.1 Gene:sgl FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001030792.1 Gene:UGD2 AraportID:AT3G29360 Length:480 Species:Arabidopsis thaliana

Alignment Length:468 Identity:298/469 (64%)
Similarity:372/469 (79%) Gaps:11/469 (2%)


  Fly     1 MKVCCIGAGYVGGPTCAVMALKCPDIVITLVDKSSERIAQWNSDKLPIYEPGLDEVVKKCRNVNL 65
            :|:||||||||||||.||:||||||:.:.:||.|..||..||||.|||||||||:|||:||..||
plant     2 VKICCIGAGYVGGPTMAVIALKCPDVEVAVVDISVPRINAWNSDTLPIYEPGLDDVVKQCRGKNL 66

  Fly    66 FFSTDIETAIKEADLIFISVNTPTKTCGNGKGRAADLKYVESAARMIAEIAQSNKIVVEKSTVPV 130
            |||||:|..::|||::|:||||||||.|.|.|:||||.|.||||||||:::.|:|||||||||||
plant    67 FFSTDVEKHVREADIVFVSVNTPTKTRGLGAGKAADLTYWESAARMIADVSVSDKIVVEKSTVPV 131

  Fly   131 RAAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRVLIGGEETPEGHQAVEKLSWIY 195
            :.||:|..||..|.| ||.:.||||||||||||||.||.|.|||||||.|||||.:||:.|..:|
plant   132 KTAEAIEKILTHNSK-GIKFQILSNPEFLAEGTAIKDLFNPDRVLIGGRETPEGFKAVQTLKNVY 195

  Fly   196 EHWIPKQNILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGSK 260
            .||:|:..|:|||.||:|||||||||||||||||:|::||:||||||||::|:.|||.|||||.|
plant   196 AHWVPEGQIITTNLWSAELSKLAANAFLAQRISSVNAMSALCEATGADVTQVSYAVGTDSRIGPK 260

  Fly   261 FLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQKRRFSQKIIESLFNTVSDK 325
            ||.:||||||||||||||||:||||...|||||.||:|||.:|:|||.||..:::.|:||:||:|
plant   261 FLNSSVGFGGSCFQKDILNLVYICECNGLPEVAEYWKQVIKINDYQKSRFVNRVVSSMFNSVSNK 325

  Fly   326 RIAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDIYDPKVEPEQIIDDLT-------HPSVTE 383
            :||:|||||||:|||||||.||.||:.|||:.|.|.||||:|..:||..||:       ||...:
plant   326 KIAVLGFAFKKDTGDTRETPAIDVCKGLLEDKARLSIYDPQVTEDQIQRDLSMNKFDWDHPLHLQ 390

  Fly   384 --SPEKVKKAVQIHSDPYSAVRATHALVICTEWDEFVDLDFKRIYQSMMKPAYIFDGRKILDHER 446
              ||..||: |.:..|.|.|.:..|.:.|.||||||.:|||::|:.:|.|||::||||.|::.::
plant   391 PMSPTTVKQ-VTVTWDAYEATKDAHGICIMTEWDEFKNLDFQKIFDNMQKPAFVFDGRNIMNLQK 454

  Fly   447 LQQIGFHVQTIGK 459
            |::|||.|.:|||
plant   455 LREIGFIVYSIGK 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 297/467 (64%)
UDPG_MGDP_dh_N 2..189 CDD:281683 132/187 (71%)
UDPG_MGDP_dh 210..305 CDD:279344 73/95 (77%)
UDPG_MGDP_dh_C 328..444 CDD:281682 64/125 (51%)
UGD2NP_001030792.1 PLN02353 1..473 CDD:177986 298/469 (64%)
UDPG_MGDP_dh_N 3..184 CDD:281683 129/182 (71%)
UDPG_MGDP_dh 210..305 CDD:279344 73/95 (77%)
UDPG_MGDP_dh_C 328..451 CDD:281682 64/124 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2520
Inparanoid 1 1.050 593 1.000 Inparanoid score I222
OMA 1 1.010
OrthoDB 1 1.010 D915490at2759
OrthoInspector 1 1.000 T124394
orthoMCL 1 0.900 OOG5_126979
Panther 1 1.100 O PTHR11374
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.