DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sgl and ugdh

Sequence 1:NP_476980.1 Gene:sgl FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001013628.1 Gene:ugdh XenbaseID:XB-GENE-950970 Length:494 Species:Xenopus tropicalis

Alignment Length:461 Identity:315/462 (68%)
Similarity:378/462 (82%) Gaps:3/462 (1%)


  Fly     2 KVCCIGAGYVGGPTCAVMALKCPDIVITLVDKSSERIAQWNSDKLPIYEPGLDEVVKKCRNVNLF 66
            |:|||||||||||||:|:|..||||.:|:||.:..||..||||.||||||||.|||:.||..|||
 Frog     6 KICCIGAGYVGGPTCSVIAQMCPDIKVTVVDVNEARINAWNSDTLPIYEPGLKEVVESCRGKNLF 70

  Fly    67 FSTDIETAIKEADLIFISVNTPTKTCGNGKGRAADLKYVESAARMIAEIAQSNKIVVEKSTVPVR 131
            :||||:.||:||||:||||||||||.|.||||||||||:|:.||.|.:.:...|||.||||||||
 Frog    71 YSTDIDGAIQEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVR 135

  Fly   132 AAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRVLIGGEETPEGHQAVEKLSWIYE 196
            |||||..|..||.||.::..:|||||||||||||.||.|.|||||||:|||||.:||..|..:||
 Frog   136 AAESIRRIFDANTKPELNLQVLSNPEFLAEGTAIRDLKNPDRVLIGGDETPEGQKAVRALCEVYE 200

  Fly   197 HWIPKQNILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGSKF 261
            ||:|.:.|:|||||||||||||||||||||||||||:||:||||||||.|||||:|:|.|||:||
 Frog   201 HWVPSEKIITTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVARAIGMDQRIGNKF 265

  Fly   262 LQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQKRRFSQKIIESLFNTVSDKR 326
            |:|||||||||||||:|||:|:||.|||.|||.|||||||||:||:|||:.:||:.|||||:||:
 Frog   266 LKASVGFGGSCFQKDVLNLVYLCEVLNLHEVARYWQQVIDMNDYQRRRFTTRIIDCLFNTVADKK 330

  Fly   327 IAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDIYDPKVEPEQIIDDLTHPSVTESPEKVKKA 391
            ||:|||||||:||||||:::|.:.:.|::|||.|.||||||..||||.||:.|.|... ::|.:.
 Frog   331 IALLGFAFKKDTGDTRESSSIYISKYLMDEGAKLHIYDPKVPREQIIMDLSQPGVAPD-DRVSQL 394

  Fly   392 VQIHSDPYSAVRATHALVICTEWDEFVDLDFKRIYQSMMKPAYIFDGRKILD--HERLQQIGFHV 454
            |.|.:|.|.|....||:|||||||.|.:|||.||::.|:|||:|||||::||  |..||.|||.|
 Frog   395 VHISTDLYEACENAHAIVICTEWDMFKELDFNRIHRMMLKPAFIFDGRRVLDELHGELQNIGFQV 459

  Fly   455 QTIGKK 460
            :|||||
 Frog   460 ETIGKK 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 313/459 (68%)
UDPG_MGDP_dh_N 2..189 CDD:281683 131/187 (70%)
UDPG_MGDP_dh 210..305 CDD:279344 80/95 (84%)
UDPG_MGDP_dh_C 328..444 CDD:281682 66/118 (56%)
ugdhNP_001013628.1 PLN02353 4..464 CDD:177986 313/459 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C287649100
eggNOG 1 0.900 E1_COG1004
Hieranoid 1 1.000
Homologene 1 1.000 H2520
Inparanoid 1 1.050 657 1.000 Inparanoid score I705
OMA 1 1.010
OrthoDB 1 1.010 D436314at33208
OrthoFinder 1 1.000 FOG0005011
OrthoInspector 1 1.000 T600585
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6673
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.