DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sgl and sqv-4

Sequence 1:NP_476980.1 Gene:sgl FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_505730.1 Gene:sqv-4 WormBaseID:WBGene00005022 Length:481 Species:Caenorhabditis elegans

Alignment Length:459 Identity:304/460 (66%)
Similarity:370/460 (80%) Gaps:5/460 (1%)


  Fly     2 KVCCIGAGYVGGPTCAVMALKCPDIVITLVDKSSERIAQWNSDKLPIYEPGLDEVVKKCRNVNLF 66
            ||.|:|||||||||||::|.|||.|.:|:||.::.:||:|||||||||||||||:|...|..|||
 Worm    11 KVVCVGAGYVGGPTCAMIAHKCPHITVTVVDMNTAKIAEWNSDKLPIYEPGLDEIVFAARGRNLF 75

  Fly    67 FSTDIETAIKEADLIFISVNTPTKTCGNGKGRAADLKYVESAARMIAEIAQSNKIVVEKSTVPVR 131
            ||:||..||.||||||||||||||..|.|||.|.|||||||.:|.||:.|...|||||||||||:
 Worm    76 FSSDIPKAIAEADLIFISVNTPTKMYGRGKGMAPDLKYVESVSRTIAQYAGGPKIVVEKSTVPVK 140

  Fly   132 AAESIMHILRANQK--PGIHYDILSNPEFLAEGTAINDLLNADRVLIGGEETPEGHQAVEKLSWI 194
            |||||..|||..||  ..:.:.:||||||||||||:.||.|.||||||||.:|||.|||.:|..|
 Worm   141 AAESIGCILREAQKNNENLKFQVLSNPEFLAEGTAMKDLANPDRVLIGGESSPEGLQAVAELVRI 205

  Fly   195 YEHWIPKQNILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGS 259
            ||:|:|:..|:||||||||||||.||||||||||||||:|||||||||::||||.|||.|:||||
 Worm   206 YENWVPRNRIITTNTWSSELSKLVANAFLAQRISSINSISAVCEATGAEISEVAHAVGYDTRIGS 270

  Fly   260 KFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQKRRFSQKIIESLFNTVSD 324
            |||||||||||||||||:|:|:|:||:||||:||.|||.||::|.:|:|||:.|||..|||||:|
 Worm   271 KFLQASVGFGGSCFQKDVLSLVYLCESLNLPQVADYWQGVININNWQRRRFADKIIAELFNTVTD 335

  Fly   325 KRIAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDIYDPKVEPEQIIDDLTHPSVTESPEKVK 389
            |:|||.|||||||||||||::||.|.:.|:||.|.|.:|||||:..|:::||.  ||| |.:.|:
 Worm   336 KKIAIFGFAFKKNTGDTRESSAIHVIKHLMEEHAKLSVYDPKVQKSQMLNDLA--SVT-SAQDVE 397

  Fly   390 KAVQIHSDPYSAVRATHALVICTEWDEFVDLDFKRIYQSMMKPAYIFDGRKILDHERLQQIGFHV 454
            :.:.:.||||:|.|..||:|:.|||||||:|::.:|:..|..||.|||||.|||.:.|::|||..
 Worm   398 RLITVESDPYAAARGAHAIVVLTEWDEFVELNYSQIHNDMQHPAAIFDGRLILDQKALREIGFRT 462

  Fly   455 QTIG 458
            ..||
 Worm   463 FAIG 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 304/460 (66%)
UDPG_MGDP_dh_N 2..189 CDD:281683 130/189 (69%)
UDPG_MGDP_dh 210..305 CDD:279344 77/95 (81%)
UDPG_MGDP_dh_C 328..444 CDD:281682 65/116 (56%)
sqv-4NP_505730.1 PLN02353 11..471 CDD:177986 304/460 (66%)
UDPG_MGDP_dh_N 11..202 CDD:281683 130/191 (68%)
UDPG_MGDP_dh 221..316 CDD:279344 77/95 (81%)
UDPG_MGDP_dh_C 339..451 CDD:281682 64/115 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C287504079
eggNOG 1 0.900 E1_COG1004
Hieranoid 1 1.000
Homologene 1 1.000 H2520
Inparanoid 1 1.050 604 1.000 Inparanoid score I502
Isobase 1 0.950 0 Normalized mean entropy S2080
OMA 1 1.010
OrthoDB 1 1.010 D436314at33208
OrthoFinder 1 1.000 FOG0005011
OrthoInspector 1 1.000 T476859
orthoMCL 1 0.900 OOG5_126979
Panther 1 1.100 LDO PTHR11374
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R6673
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.