DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10075 and uqcc1

Sequence 1:NP_648064.1 Gene:CG10075 FlyBaseID:FBgn0035722 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_989308.1 Gene:uqcc1 XenbaseID:XB-GENE-1017093 Length:300 Species:Xenopus tropicalis

Alignment Length:234 Identity:82/235 (35%)
Similarity:133/235 (57%) Gaps:18/235 (8%)


  Fly    27 HR-PAILGLLEQPCRLCSSTGVVDNTNKTKPGTAEAAEGGI--LKRVLNKVGFT---PNTKARLK 85
            || ||:...:.:|..       |.:||:|.....:.:|..:  ..:::..:|||   ...|.::|
 Frog    58 HRTPAVASQIWRPLH-------VTHTNQTTKDKLQPSEEEVSTFTKIIEAMGFTGPLKYNKWKIK 115

  Fly    86 VTSHLLYESVADKINYVTFFRDFNLPNTFNSWFLVTELHVWLLLMRSMAEGSETGEDGRFLRNCI 150
            :.:..:|....::|:|..||...:||:|.|||||||:||||:.|:|...|    |..|:::...:
 Frog   116 IAALRMYTCCVERIDYDEFFEKCSLPDTLNSWFLVTQLHVWMCLVRMKQE----GRAGKYMCRYV 176

  Fly   151 VEAMWGDVNTRAKKLGAHNPSRTRQQIETLSEQFQAALIAYDEGIMSDDRVLACALWRRFFEMNC 215
            |.:||.||..|.|.:|..:.: .:..:.:::|.|.||:..|||||:||||:||.||||..|...|
 Frog   177 VHSMWEDVEQRGKVMGIDSVT-LKNSMRSMTEIFYAAIFGYDEGIISDDRILAAALWRNLFNKQC 240

  Fly   216 DDYAQIERLVKYVRQQASMLDSLPRDQFIVKPKVAWLEL 254
            ||..::|.:|:|||:|...||:|..:..::..:|.|..|
 Frog   241 DDPRKLELIVEYVRKQVQFLDTLDGEDLLLTGEVVWRPL 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10075NP_648064.1 Ubiq_cyt_C_chap 106..245 CDD:281912 59/139 (42%)
uqcc1NP_989308.1 Ubiq_cyt_C_chap 136..274 CDD:309198 59/143 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C183808796
eggNOG 1 0.900 E1_KOG2873
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H14709
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1428265at2759
OrthoFinder 1 1.000 FOG0004388
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.