DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10075 and C35D10.5

Sequence 1:NP_648064.1 Gene:CG10075 FlyBaseID:FBgn0035722 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_498013.2 Gene:C35D10.5 WormBaseID:WBGene00016442 Length:244 Species:Caenorhabditis elegans

Alignment Length:250 Identity:68/250 (27%)
Similarity:114/250 (46%) Gaps:55/250 (22%)


  Fly    40 RLCSSTGVVDNTNKTKPGTAEAAEGGILKRVLNKV------------------GFTPNTKARLKV 86
            ||.:|:.|:.|.||.   |.|.....:|:..:::|                  |...:.|:.|..
 Worm    11 RLATSSRVLSNANKK---TVEDMTQEMLQMPVSRVPPTIQRFATSLKMKFKSDGLDQSVKSILDR 72

  Fly    87 TSHLLYESVADKINYVTFFRDFNLPNTFNSWFLVTELHVWLLLMRSMAEGSETGEDGRF---LRN 148
            .|..||.:.||..::......|.|.:..:||:.:|.:|.|::|||..:|     .||:.   |:.
 Worm    73 ASAQLYYNCADNYDFAKLCEAFGLGDYMSSWYKLTLMHTWMVLMRLHSE-----FDGKAYMRLQR 132

  Fly   149 CIVEAMWGDVNTR----AKKLGAHNPSRTRQ---------QIETLSEQFQAALIAYDEGIMSDDR 200
            .::..||.|::.|    :|:|   |...|.|         .::|..|        ||||.:.|||
 Worm   133 GLLSTMWLDIDNRLGIVSKEL---NQIMTGQNDMKHMHGLHLQTFFE--------YDEGFLHDDR 186

  Fly   201 VLACALWRRFFEMNCD-DYAQIERLVKYVRQQASMLDSLPRDQFIVKPKVAWLEL 254
            |||.|:||..: ||.: |...:.::|.|:|...:.|::...:|.:|:....|.:|
 Worm   187 VLAGAIWRCLY-MNREVDPIHLLKVVTYMRSTVAWLETQDTNQILVEGISEWKQL 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10075NP_648064.1 Ubiq_cyt_C_chap 106..245 CDD:281912 46/156 (29%)
C35D10.5NP_498013.2 Ubiq_cyt_C_chap 92..234 CDD:281912 47/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C183816492
eggNOG 1 0.900 E1_KOG2873
Hieranoid 1 1.000
Homologene 1 1.000 H14709
Inparanoid 1 1.050 77 1.000 Inparanoid score I3796
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1428265at2759
OrthoFinder 1 1.000 FOG0004388
OrthoInspector 1 1.000 T476669
orthoMCL 1 0.900 OOG5_129684
Panther 1 1.100 LDO PTHR12184
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R171
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.