DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and si:ch211-207i20.3

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio

Alignment Length:240 Identity:59/241 (24%)
Similarity:92/241 (38%) Gaps:54/241 (22%)


  Fly     3 TSYKKNRPFDFK-----LIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRW 62
            |.|...|....|     |:.||..|..|:.::. |.|...|.|..:|..||:.||.||:....:|
Zfish    18 THYSVRRSMVVKMDAELLLFLVSENKELFDKNH-SEYKNTKRKEALWQGIADKMGVDVEEVKAKW 81

  Fly    63 NNLHYQFRKEFRRADTSGS----------TWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTE 117
            .||...:.:: :|.:..||          .|.|:..:.||           .|.|..:...:.::
Zfish    82 KNLRDTYTRK-KRLEQDGSRSGRAAKKKKQWKYMRVMDFL-----------DPATEHRSGILDSK 134

  Fly   118 TPVQFLWDTFEDGDVPQQSSTFIIEEVIEEPSEQIIQEEIIYEEQEPAEIIS-PRSSFLQ-MDQI 180
                     .|| |.|.:.|.       .||:.......:...|...:.|:. .||..|: :::.
Zfish   135 ---------IED-DEPDEDSG-------AEPASTSTGTSVTSPEAMRSSIVKRRRSETLELLEKY 182

  Fly   181 LAQLKEPQRRRAERR---ITAFL--LKCQLRAL--SNQSVEDLSI 218
            ||......|.:.|::   :..||  |...||.|  |.||:..|.|
Zfish   183 LATKDAKDREKDEQQQDEVDLFLRSLAPALRRLPASKQSLVKLQI 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 27/96 (28%)
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 26/100 (26%)
BESS 199..233 CDD:308542 11/30 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000566
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.