DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and Dlip3

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_525003.2 Gene:Dlip3 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster

Alignment Length:288 Identity:57/289 (20%)
Similarity:99/289 (34%) Gaps:92/289 (32%)


  Fly    11 FDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRR 75
            ||.:||.||..||.:|..|. .:|.....:.|||.|||..:|....|...:|.|:.|.:.:|.:.
  Fly    31 FDDRLIKLVRANPAIYDVSH-PHYRRNPVRVDIWDRIANELGASSRFLQTKWKNIRYNYLQEVKA 94

  Fly    76 ADTSGSTWPYLERLRFLAEI-------QPPSKVKTKPKTNKQEATIQTETPVQFLW--------- 124
            .:| |...|.:.:.||..::       |..:..|::....:|...........||:         
  Fly    95 IET-GQANPNVRKRRFTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYPDPEHLKID 158

  Fly   125 ----------DTFEDGD-------VPQQSSTFIIEEVIEEPSEQI-------------------- 152
                      |..:||.       ||:      ::.|:.|..:|:                    
  Fly   159 ASEGYDIIELDNSDDGSNSDDNEIVPE------LQLVMGESKQQLSLPTTLNGTSSSNHSHEHDQ 217

  Fly   153 -------------------IQEEIIYEEQEPAEIISPRSSFLQMDQILAQ--LKEPQRRRA---- 192
                               ..:|:..|:|:..|....::|.|...::..:  .|....|||    
  Fly   218 ASSPASSPLLTPMVVMGNGYGQEVHLEQQQTQEQKPFKNSSLSNGEVTIEPIYKPAAIRRALPSD 282

  Fly   193 ------ERRITAFLLKCQLRALSNQSVE 214
                  :|:.|...|:.|:.:..|..:|
  Fly   283 FLTNPFKRKATQAPLQTQVTSSFNDPIE 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 26/81 (32%)
Dlip3NP_525003.2 MADF 34..118 CDD:214738 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000566
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.