DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and Adf1

DIOPT Version :9

Sequence 1:NP_648063.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:94/252 - (37%) Gaps:62/252 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRR 75
            ||..||:.|:.|||:|.||.. ||.....|...|.:|||.:|.....|..||.:|..:|.:|.:.
  Fly    12 FDLNLIEAVKLNPVIYDRSHY-NYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKL 75

  Fly    76 ADTSGSTWPYLERLRFLA----------------------EIQPPSKVKTKPKTNKQEATIQT-- 116
            ...  |.|.|.::::||.                      ::..||:        :|:|..||  
  Fly    76 CQE--SRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQ--------QQQAQQQTVV 130

  Fly   117 -----------ETPVQFLWDTFE-----DGD----VPQQSSTFIIEEVI------EEPSEQIIQE 155
                       .|..|.|....|     |..    |.:....:..|..:      ||.|:.::..
  Fly   131 DIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNT 195

  Fly   156 EIIYEEQEPAEIISPRSSF-LQMDQILAQLKEPQRRRAERRITAFLLKCQLRALSNQ 211
            ..|::......:.:...|| :.:..:|..|...|:..|:..|..:|...||.|..|:
  Fly   196 IKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQHNK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_648063.1 MADF 14..95 CDD:214738 28/102 (27%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 28/82 (34%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.