DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and Adf1

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster

Alignment Length:252 Identity:59/253 (23%)
Similarity:94/253 (37%) Gaps:62/253 (25%)


  Fly    11 FDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRR 75
            ||..||:.|:.|||:|.||.. ||.....|...|.:|||.:|.....|..||.:|..:|.:|.:.
  Fly    12 FDLNLIEAVKLNPVIYDRSHY-NYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKL 75

  Fly    76 ADTSGSTWPYLERLRFLA----------------------EIQPPSKVKTKPKTNKQEATIQT-- 116
            ...  |.|.|.::::||.                      ::..||:        :|:|..||  
  Fly    76 CQE--SRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQ--------QQQAQQQTVV 130

  Fly   117 -----------ETPVQFLWDTFE-----DGD----VPQQSSTFIIEEVI------EEPSEQIIQE 155
                       .|..|.|....|     |..    |.:....:..|..:      ||.|:.::..
  Fly   131 DIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNT 195

  Fly   156 EIIYEEQEPAEIISPRSSF-LQMDQILAQLKEPQRRRAERRITAFLLKCQLRALSNQ 211
            ..|::......:.:...|| :.:..:|..|...|:..|:..|..:|...||.|..|:
  Fly   196 IKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQHNK 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 28/103 (27%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000566
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.