DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and jigr1

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster

Alignment Length:155 Identity:42/156 (27%)
Similarity:68/156 (44%) Gaps:19/156 (12%)


  Fly     2 RTSYKKNRPFDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLH 66
            |.:|.:...||..||.....:||||.||.....|.:.. ..||.:||..:|.|......|...|.
  Fly    20 RATYAQTGEFDLGLIREYRSHPVLYDRSNKRFKDKLYV-AHIWEQIAHKLGYDATSIRERMTTLR 83

  Fly    67 YQFRKEFRRAD----TSGSTWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTETPVQFLWDTF 127
            .::..|.||.:    |..|.||..|.|:||.:       ..:|:.:.:..:::.|..     :|:
  Fly    84 NRYNIEKRRVENGLSTQSSQWPLFESLQFLGD-------HIRPRRSFKNMSVKEEDE-----ETY 136

  Fly   128 EDGDVPQQSSTFI--IEEVIEEPSE 150
            |..|....|:..:  |::.:|:.||
  Fly   137 EVDDCRSDSNGHMNSIKDELEDDSE 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 28/85 (33%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.