DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and CG6276

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster

Alignment Length:270 Identity:53/271 (20%)
Similarity:93/271 (34%) Gaps:88/271 (32%)


  Fly    13 FKLIDLVEPNPVLYK--------RSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQF 69
            ||||::|:.:..:|.        |..:.|:         |..:...:..:....|.:|.||...|
  Fly    31 FKLIEIVQRDEAIYNPRHKYYFCRPYVENF---------WREVDLKLEKNPGASLAKWTNLRISF 86

  Fly    70 RKEFRR--ADTSGSTWPYLERLRFL-----AEIQPPSKVKTKPK-------------TNKQEATI 114
            |:|:..  .:.....|.|.:|:.||     .:.|.|..:.|:.:             ..::..||
  Fly    87 RREYTNYLEEKVPPCWSYFDRMFFLHPYLRKKHQQPKSLDTQVQDALAHLSNLSSRMQRERSVTI 151

  Fly   115 --------------QTETPVQFL---WDTFEDGDVPQQSSTFIIEE------------------- 143
                          ....|.|.|   .|.|::.:........|:||                   
  Fly   152 PGSSSIGGQPTPSAHQSPPAQQLDNYLDYFDEAEHNNSELDDIMEEEQQRNSRYHGQLDGNDIKS 216

  Fly   144 VIEEPSEQIIQE--EIIYEEQEPAEI--ISPRSSFLQMDQILAQLKEPQRRRAERRITAFLL--- 201
            ..|||.:...||  |...:||:..::  ::|.||        :...|.|||.|.:...|..:   
  Fly   217 ECEEPVDDYEQEAHEPEEDEQDDQDLHKMAPTSS--------SSSAEAQRRYANQHSHASRMLPG 273

  Fly   202 KCQLRALSNQ 211
            :.|:|...::
  Fly   274 RLQMRTYHDE 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 20/96 (21%)
CG6276NP_650445.3 MADF 32..116 CDD:214738 20/93 (22%)
BESS 431..465 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.