DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and stwl

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster

Alignment Length:209 Identity:42/210 (20%)
Similarity:66/210 (31%) Gaps:57/210 (27%)


  Fly    15 LIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRK------EF 73
            |:..||....||.|:. .||.......:.|..:|..:|..|:.|..||..|...:.:      ..
  Fly    11 LLRSVEKQTALYDRTD-ENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNADANR 74

  Fly    74 RRADTSGSTWPYLERLRFL----------AEIQPPSKVKTKPKTNKQE----------------- 111
            ||.......:|..:.||||          |.....|....|.:.|.::                 
  Fly    75 RRNGQRRLAYPLADELRFLDRHLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQASLKERAS 139

  Fly   112 ------------ATIQTETPVQFLWDTFEDGDVPQQSSTFIIEEVIEEPSEQIIQEEIIYEEQEP 164
                        :.::.|...|...:.:|:....|:|.....||.:.:           .||.:.
  Fly   140 STSKLVKEVKLASQVRKEKSSQDKRENWENPGDKQRSRKKSAEEKLND-----------LEESDE 193

  Fly   165 AEIISPRSSFLQMD 178
            .|.:....||||.|
  Fly   194 PEKVPELDSFLQSD 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 24/96 (25%)
stwlNP_001261839.1 MADF 11..98 CDD:214738 23/88 (26%)
BESS 604..637 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.