DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and CG6163

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001261709.1 Gene:CG6163 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster

Alignment Length:126 Identity:32/127 (25%)
Similarity:53/127 (42%) Gaps:15/127 (12%)


  Fly     6 KKNRPFDF------KLIDLVEPNPVLYKRSGLSNYDAMKAKTD-IWARIAEMMGCDVDFCLMRWN 63
            |..||...      ::||.::..|.|:.....|.....:::|. :|...|..||........||:
  Fly   212 KLGRPSSLHNSMRGRIIDAIKTRPSLWAGRQRSEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWS 276

  Fly    64 NLHYQFRKEF---RRADTS----GSTWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTE 117
            .:..::..|.   |.|..|    .|||.:.:|:.|:.||. ..||..:.:|.:|...|.:|
  Fly   277 IIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREIL-LKKVDEREQTREQIQEIVSE 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 22/89 (25%)
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 23/90 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.