DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and CG7745

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:112 Identity:35/112 - (31%)
Similarity:55/112 - (49%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DFKLIDLVEPNPVLYKR-----SGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRK 71
            |.:|||.|..:.|:|.|     :|.:|....:.|.:.|..||..:..|||.|..||..|..::..
  Fly     3 DEQLIDEVAQHGVIYNRQKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRERYVS 67

  Fly    72 EFRRADT---SGSTWPYLERLRFLAE-IQPPSKVKTKPK--TNKQEA 112
            :.::.|.   ...:.||||:::||.: |||....:..|.  |:.|.|
  Fly    68 QRKQGDPPVYEHLSRPYLEKMKFLDQHIQPRKSYRHVPNFLTSPQSA 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 27/89 (30%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.