DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and CG11723

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster

Alignment Length:218 Identity:53/219 (24%)
Similarity:80/219 (37%) Gaps:44/219 (20%)


  Fly    12 DFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRRA 76
            :::||..|.....|:..:...:|....|... ||.:|::|..||..|..|:..:...:|.|.|:.
  Fly     5 NYRLIQEVSKRRCLWDTNMSISYRNQDAALQ-WASVAQIMQQDVSICKKRFKGMRDSYRAEVRKI 68

  Fly    77 DTSG---STWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTETP--------VQFLWDTFEDG 130
            ....   |.|||...|.|:.:|..|..:...|   .:...:.||.|        |.|..|...|.
  Fly    69 QQKRIEMSHWPYFRSLEFMRQIFDPEGLVPFP---PEPFVMNTEQPEVFEPTRLVDFAIDLDLDN 130

  Fly   131 DVPQQSSTF-IIEEVIE-EPSEQIIQEEIIYEEQEPAEIISPRSS------------------FL 175
            |   .|..| |||::.: |||  :.|:    ...:...:|.|..|                  .|
  Fly   131 D---DSVDFEIIEDIFKREPS--VPQD----SGSDKGSLIKPLDSSSSGAHRSDQDLSPTLPIHL 186

  Fly   176 QMDQILAQLKEPQRRRAERRITA 198
            ...|.......|..:|..||.|:
  Fly   187 PRHQQFLPRPPPPSKRGRRRKTS 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 23/84 (27%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 24/85 (28%)
BESS 236..270 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.