DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and CG8119

DIOPT Version :10

Sequence 1:NP_648063.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:209 Identity:44/209 - (21%)
Similarity:84/209 - (40%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 WARIAEMMGCDVDFCLMRWNNLHYQFRKEFRRADTSGSTWPYLERLRFLAEIQPPSKVKT----K 104
            |..::..:|..||.|..||.:|...:|.:..:.  :..:||:.:::.|:.::.||.|.||    :
  Fly    46 WLDVSNAVGLGVDECKRRWKSLRNNYRTKIHQG--NAWSWPHSKQMEFVRDVFPPHKPKTPARCR 108

  Fly   105 PKTNKQEATIQTETPVQFL-----WDTFEDGDVPQQSSTFIIEE----VIEEPSEQI-IQEEI-- 157
            .:..|.:..:.   |.|:|     :..|:.|.:     .|..||    |.:||:..: :.||:  
  Fly   109 VQVKKSKLILH---PQQYLQSVASYSAFKKGGI-----EFEAEERLFLVTDEPAFDLDVDEEVTR 165

  Fly   158 -------------------IYEEQEPAEII-----SPRSSFLQMDQILAQLKEPQRRRAE---RR 195
                               |:....|:.:.     |.|...|.|..:|..|.:..:.|..   ||
  Fly   166 LLGTDQWLWQTNLDFILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSDRSKERFRSWTRR 230

  Fly   196 ITAFLLKCQLRALS 209
            :...:|..:.:.|:
  Fly   231 VLREMLIAEKKLLT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_648063.1 MADF 14..95 CDD:214738 12/50 (24%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 12/52 (23%)
BESS 201..234 CDD:460758 9/32 (28%)

Return to query results.
Submit another query.