DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and CG12155

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_572403.1 Gene:CG12155 FlyBaseID:FBgn0029957 Length:555 Species:Drosophila melanogaster

Alignment Length:177 Identity:40/178 (22%)
Similarity:78/178 (44%) Gaps:45/178 (25%)


  Fly     5 YKKNRPFD--FKLIDLVEPNPVLYKRSGLSNYDA---MKAKTDI---WARIAEMMG--CDVDFCL 59
            :|.|.|.|  ..||:||..|||||      ||..   .:.::|:   |..:|:.:|  ..|....
  Fly    12 HKDNAPTDDILTLINLVRQNPVLY------NYKLQPNQRRRSDVLNGWQEVAQQIGNKYTVQEVR 70

  Fly    60 MRWNNLH---YQFR-KEFRRADTSGSTWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTETPV 120
            .:|.||.   :|:| :..:..:...|.|.|.:.|.||:::..| |:|:...|             
  Fly    71 RKWKNLRDTFHQYRLRTPKYIEGRLSKWRYAKELDFLSKVYQP-KLKSHRNT------------- 121

  Fly   121 QFLWDTF----EDGDVPQQSSTFI-------IEEVIEEPSEQIIQEE 156
            |..::|.    ..|.:...:||.:       :::.:::..::::.::
  Fly   122 QITYETSGVAGAGGGIGGANSTTLPIGAMLHLKQHVDDDDDEVMDDD 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 27/93 (29%)
CG12155NP_572403.1 MADF 24..112 CDD:214738 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000566
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.