DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and madf-9

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans

Alignment Length:141 Identity:37/142 (26%)
Similarity:64/142 (45%) Gaps:20/142 (14%)


  Fly    11 FDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFR- 74
            |:.:||..|:..|.||.:|. ..|:.:..:...|..|||.:....:....||..|..:::||.: 
 Worm    49 FNIRLIAEVKARPFLYDQSD-EGYNLLSWRNSAWNEIAENLETTSEHVKTRWKTLRDRYKKEEKK 112

  Fly    75 -RADTSGSTWPYLERLRFLAEIQPPSKVKTKPKT--NKQEATIQTETPVQFLWDTFEDGDV-PQQ 135
             |.....|:|.:...|:|   ||...|.:...:|  |:.|..::.|          .:|.| |.:
 Worm   113 ERVSKKASSWVFQRPLKF---IQAHLKDRHTDETDSNQSEPAVKPE----------PNGHVSPME 164

  Fly   136 SS-TFIIEEVI 145
            :: :||..|:|
 Worm   165 AAMSFIENELI 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 22/83 (27%)
madf-9NP_500389.2 MADF 52..136 CDD:214738 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000566
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.