DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9948 and LOC110439798

Sequence 1:NP_001261492.1 Gene:CG9948 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_021332041.1 Gene:LOC110439798 ID: Length:273 Species:Danio rerio

Alignment Length:178 Identity:44/179 (25%)
Similarity:76/179 (42%) Gaps:46/179 (26%)


  Fly    23 PVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFR----RADTSGST- 82
            |:|:.|. .::|.:.:.:..:|..:|..:|..|..|..||..:..::.:|.|    :.|..|.. 
Zfish    40 PLLHNRL-RTDYRSTERRERVWRDVAASIGLSVVECKRRWKTIRDRYIRERRLCKLKKDLGGRRL 103

  Fly    83 --WPYLERLRFL-AEIQP---PSKVKTKPKTNKQEATIQTETPVQFLWDTFEDGDVPQQSSTFII 141
              ||:.|.|.|| |.|:.   ||..: .|:..:||                      :.||.   
Zfish   104 HYWPHRESLAFLDAHIRKRRRPSGAQ-GPEEEQQE----------------------EHSSA--- 142

  Fly   142 EEVIEEPSEQIIQEEIIYEEQEPAEIISPRSSFLQMDQILAQLKE-PQ 188
              .::|..|:.:|||.:   .:.:..:||.:. |.: .|:.|||. ||
Zfish   143 --ALQEDKEECVQEECV---SDSSRFVSPLNP-LPL-SIVTQLKPVPQ 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 22/80 (28%)
LOC110439798XP_021332041.1 MADF 32..120 CDD:214738 23/81 (28%)
BESS 233..267 CDD:308542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000566
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.