DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tow and C1orf21

DIOPT Version :8

Sequence 1:NP_001261489.1 Gene:tow / 38755 FlyBaseID:FBgn0035719 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_110433.1 Gene:C1orf21 / 81563 HGNCID:15494 Length:121 Species:Homo sapiens

Alignment Length:131 Identity:40/132 (30%)
Similarity:62/132 (47%) Gaps:28/132 (21%)


  Fly     1 MGCGQSKIHL-------YPRKSKSKANGKKGGHADSDAETDEDEGHIEDAEKAQQRDREKHDESE 58
            |||..:| |:       ..:|.|:..||...|          ||..|:..|:.:.. :...:|.:
Human     1 MGCASAK-HVATVQNEEEAQKGKNYQNGDVFG----------DEYRIKPVEEVKYM-KNGAEEEQ 53

  Fly    59 ELSNKDIQESDEDVAVSLLRAKNLSLL--------QSQEISSSQQNFFRMLDKKIDEGPDYDSAS 115
            :::.:: ||:.|..|.|.:|.|....:        .:..||.|||.||||||:||::|.||.|..
Human    54 KIAARN-QENLEKSASSNVRLKTNKEVPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEE 117

  Fly   116 E 116
            |
Human   118 E 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
towNP_001261489.1 DUF4612 2..116 CDD:292032 38/129 (29%)
C1orf21NP_110433.1 DUF4612 2..118 CDD:317755 38/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187144012
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.