DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tow and c1orf21

DIOPT Version :9

Sequence 1:NP_001261489.1 Gene:tow / 38755 FlyBaseID:FBgn0035719 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001072652.1 Gene:c1orf21 / 780109 XenbaseID:XB-GENE-5830151 Length:121 Species:Xenopus tropicalis


Alignment Length:128 Identity:41/128 - (32%)
Similarity:65/128 - (50%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCGQSKIHLYPRKSKSKA-NGKKGGHADSDAETDEDEGHIEDAEKAQQRDREKHDESEELSNKD 64
            |||..:| |:...:::..| |||...:.|:..    ||..|:..|:.:..   |:.|.||  .|.
 Frog     1 MGCASAK-HVSTVQNEDDAQNGKNYQNGDAFC----DEYRIKPVEEVKYM---KNGEEEE--QKV 55

  Fly    65 IQESDEDVAVSLLR-AKNLSLLQSQ----------EISSSQQNFFRMLDKKIDEGPDYDSASE 116
            :..:.|::..|:.. |::.|.:::.          .||.|||.||||||:||::|.||.|..|
 Frog    56 VSRNQENLEKSVTHAARSRSNVEAAGAGHPYRINIHISESQQEFFRMLDEKIEKGQDYCSEEE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
towNP_001261489.1 DUF4612 2..116 CDD:292032 39/125 (31%)
c1orf21NP_001072652.1 DUF4612 2..118 CDD:373811 39/125 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.