DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14820 and CG18585

Sequence 1:NP_648060.1 Gene:CG14820 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster

Alignment Length:420 Identity:190/421 (45%)
Similarity:260/421 (62%) Gaps:8/421 (2%)


  Fly     2 LLKILLVVGLFGLARSVEQVRYDNYKVYNVRIDDLEQFKLLH-TQERSLKLSSWREARHLGESSD 65
            ||..|:.:...|:.:...:.||||::||.:.|.:..|...:. ..|.:.|.:.|:|........|
  Fly     6 LLATLVALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKKYNIWKEYDERSRQID 70

  Fly    66 IMLPPEYQKTFESLLTKHNFTYNLKIDNVQTHIDAQR--PKQRITSMEWTQFHTLEEIYAWLDVI 128
            ||:.|.....|:.||..:|.:..|.|:|||..||.::  |.....:..||:::.||||.||||.|
  Fly    71 IMVSPGELNHFQELLKFNNISSELMIENVQERIDEEQVTPTADSATFGWTKYYELEEIEAWLDEI 135

  Fly   129 EDRYPDIVTPFTIGNSYEGRPIRGVKISYKEGNPAVFIESNIHAREWITSATITYFIDELLVPRN 193
            .:.||.:...|.:|.|||||.|||:|||:|.|||.:|||||||||||||||:.|:||::||...:
  Fly   136 LNAYPSVTEEFIVGKSYEGRTIRGIKISHKAGNPGIFIESNIHAREWITSASATWFINQLLTSED 200

  Fly   194 PAVRDIAQNVDWYIIPVLNTDGFAYSHEVERLWRKSRLPSDPTGECIGTDLNRNFDYLWML-TGA 257
            ..||.:|.|.||:||||.|.|||.|||:.:|:|||:|.| ..|..|||.|.|||||..|:. .||
  Fly   201 ADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQP-HATNACIGADANRNFDSYWLQNNGA 264

  Fly   258 ESDPCSQLYAGPSPESDPEISQLTAYINNSIPEGTIKIYISLHSYGQYVLSPWGHTALEFPEHYP 322
            ..:|||:.:||.:|||:||...|..|:...  :..|.:|||.||||||:|||:|||..||||:|.
  Fly   265 SDNPCSETFAGDNPESEPEAKALVEYLTKI--QDQISVYISFHSYGQYLLSPYGHTNEEFPENYN 327

  Fly   323 QMMHVAKGFSDALYR-RYGTVFTYGSSATTLYEVSGSGKEWAYAVKNIKIHYTIELRDKGELGFV 386
            .::.:.|.|:||:.. .||||:.|||:|..||..:|:..:|.:.....||.||||.||||..||:
  Fly   328 DILTIGKAFADAIEALPYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEYRDKGRYGFI 392

  Fly   387 LPPEDIIPVAREVTEGFVGMIAAAREIDIL 416
            |||..|||...|:..|.:.:|...:|:..|
  Fly   393 LPPVQIIPNCEELMVGMLALIEKTKELGYL 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 21/70 (30%)
M14_CP_A-B_like 115..410 CDD:199844 154/297 (52%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 21/71 (30%)
M14_CP_A-B_like 122..415 CDD:199844 154/296 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133389266
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.