DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and RTC3

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_011955.1 Gene:RTC3 SGDID:S000001129 Length:111 Species:Saccharomyces cerevisiae

Alignment Length:40 Identity:13/41 (32%)
Similarity:21/41 (51%) Gaps:7/41 (17%)


  Fly   213 LLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESEELF 252
            |::......::||.::|.:.||       |.||||..|:|
Yeast    16 LIVFAASEELVDEYLKNPSIGK-------LSEVVELFEVF 48

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 4/18 (22%)
SBDS 18..99 CDD:279511
SBDS_C 110..227 CDD:286465 3/14 (21%)
RTC3NP_011955.1 SBDS 6..95 CDD:307362 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10927
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.