Sequence 1: | NP_001261482.1 | Gene: | CG8549 / 38749 | FlyBaseID: | FBgn0035714 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011955.1 | Gene: | RTC3 / 856487 | SGDID: | S000001129 | Length: | 111 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 40 | Identity: | 13/40 - (32%) |
---|---|---|---|
Similarity: | 21/40 - (52%) | Gaps: | 7/40 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 213 LLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESEELF 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8549 | NP_001261482.1 | PTZ00448 | 4..>226 | CDD:185627 | 2/12 (17%) |
RTC3 | NP_011955.1 | SBDS | 6..95 | CDD:395934 | 13/40 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10927 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |