DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and SDO1

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_013122.1 Gene:SDO1 SGDID:S000004012 Length:250 Species:Saccharomyces cerevisiae

Alignment Length:242 Identity:106/243 (44%)
Similarity:155/243 (64%) Gaps:12/243 (5%)


  Fly     7 PTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAKKDE 71
            |:.||:||||::|||||..||||:|||:|||..:|...|||:|||||.|.||.|||||..|.|::
Yeast     6 PSGQIKLTNVSLVRLKKARKRFEVACYQNKVQDYRKGIEKDLDEVLQIHQVFMNVSKGLVANKED 70

  Fly    72 LQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASIIEK 136
            |||.|..|:..::.:||:.|||:|:||||||..|:...|.::..|:|.|:||.:::.||.::|.|
Yeast    71 LQKCFGTTNVDDVIEEIMHKGEIQLSEKERQLMLNKVNNEMLTIVSAKCINPVSKKRYPPTMIHK 135

  Fly   137 SLKDAHFSVKMNRNTKQNTLEAIKIL--KDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANAV 199
            :|::..||..:|:..|...|||||:|  |..:||.|::||::|:.:......:|.|.:.||..:.
Yeast   136 ALQELKFSPVINKPAKLQALEAIKLLVSKQIIPIVRAKMKVKVAISEPSRQPELIEKISKLIASS 200

  Fly   200 EHE----EWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLEL 242
            ..|    |.|..|  .|.||||..||.:..|...    ||.:::|::
Yeast   201 PGESTKPELDPWT--CTGLIDPVNYRDLMTLCDK----KGTVQVLDM 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 102/227 (45%)
SBDS 18..99 CDD:279511 47/81 (58%)
SBDS_C 110..227 CDD:286465 44/123 (36%)
SDO1NP_013122.1 SBDS_C 9..244 CDD:331463 105/240 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C208065131
eggNOG 1 0.900 E1_COG1500
Hieranoid 1 1.000
Homologene 1 1.000 H6438
Inparanoid 1 1.050 183 1.000 Inparanoid score I935
Isobase 1 0.950 0 Normalized mean entropy S584
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004541
OrthoInspector 1 1.000 T1136634
orthoMCL 1 0.900 OOG5_127367
Panther 1 1.100 LDO PTHR10927
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1300
TreeFam 1 0.960
1312.830

Return to query results.
Submit another query.