DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and AT1G43860

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_564488.1 Gene:AT1G43860 AraportID:AT1G43860 Length:370 Species:Arabidopsis thaliana

Alignment Length:258 Identity:119/259 (46%)
Similarity:162/259 (63%) Gaps:21/259 (8%)


  Fly     1 MSK-IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKG 64
            ||| :..|..|.||||||:|||||.|.||||||||||||||||..|||||||||:|||::|||||
plant     1 MSKTLVQPVGQKRLTNVAVVRLKKQGNRFEIACYKNKVLSWRSGVEKDIDEVLQSHTVYSNVSKG 65

  Fly    65 QAAKKDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPY 129
            ..||..:|.|:|...|.|:||.:||.||||||:.|||:|...:|...|...|....:||||:|||
plant    66 VLAKSKDLMKSFGSDDHTKICIDILEKGELQVAGKERESQFSSQFRDIATIVMQKTINPETQRPY 130

  Fly   130 PASIIEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGG---KLKE- 190
            ..|::|:.:.:.||:|..:.|:|:..|:.|:.|:.|.||:||.|:||::...:....   |||| 
plant   131 TISMVERLMHEIHFAVDPHSNSKKQALDVIRELQKHFPIKRSPMRLRLTVPVQNFPSLLEKLKEW 195

  Fly   191 --SVVKLANAVEHEEWDEATLHLTLL--IDPGQYRVIDELVRNETKGKGLLELLELKEVVESE 249
              |||..         ||:...::.:  ::||.:|..|..||:.   :|.||:|.:....|.:
plant   196 DGSVVSK---------DESGTQMSTVCEMEPGLFRECDSHVRSI---QGRLEILAVSVHAEGD 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 110/229 (48%)
SBDS 18..99 CDD:279511 56/81 (69%)
SBDS_C 110..227 CDD:286465 40/125 (32%)
AT1G43860NP_564488.1 PTZ00448 4..351 CDD:185627 116/256 (45%)
SBDS 19..97 CDD:279511 55/78 (71%)
SBDS_C 109..227 CDD:286465 41/127 (32%)
ZnF_U1 311..339 CDD:197732
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6438
Inparanoid 1 1.050 202 1.000 Inparanoid score I1265
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1217666at2759
OrthoInspector 1 1.000 T192591
orthoMCL 1 0.900 OOG5_127367
Panther 1 1.100 LDO PTHR10927
Phylome 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.