DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and SBDS

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_057122.2 Gene:SBDS HGNCID:19440 Length:250 Species:Homo sapiens

Alignment Length:249 Identity:147/250 (59%)
Similarity:185/250 (74%) Gaps:2/250 (1%)


  Fly     4 IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAK 68
            ||||||||||||||:||:|:.|||||||||||||:.|||..|||:|||||||:||.||||||.||
Human     3 IFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAK 67

  Fly    69 KDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASI 133
            |::|..||...|:|||||:||:|||:|||:|||.:.|:.....|...||..||||||:|||...:
Human    68 KEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVIL 132

  Fly   134 IEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANA 198
            ||:::||.|:|||.|::|||..||.||.||:.|.|||:.|:||......| |.||||.:..|...
Human   133 IERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNE-GKKLKEKLKPLIKV 196

  Fly   199 VEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESEELF 252
            :|.|::.: .|.:..|||||.:|.||||::.||||||.||:|.||:|.|.:|.|
Human   197 IESEDYGQ-QLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKF 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 127/221 (57%)
SBDS 18..99 CDD:279511 57/81 (70%)
SBDS_C 110..227 CDD:286465 57/117 (49%)
SBDSNP_057122.2 PTZ00448 1..>223 CDD:185627 131/222 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C208054494
eggNOG 1 0.900 E1_COG1500
Hieranoid 1 1.000
Homologene 1 1.000 H6438
Inparanoid 1 1.050 290 1.000 Inparanoid score I2773
Isobase 1 0.950 0 Normalized mean entropy S584
OMA 1 1.010
OrthoDB 1 1.010 D1217666at2759
OrthoFinder 1 1.000 FOG0004541
OrthoInspector 1 1.000 T1074745
orthoMCL 1 0.900 OOG5_127367
Panther 1 1.100 LDO PTHR10927
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1300
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.