DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and sbds

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001004953.1 Gene:sbds XenbaseID:XB-GENE-1003506 Length:250 Species:Xenopus tropicalis

Alignment Length:249 Identity:153/250 (61%)
Similarity:188/250 (75%) Gaps:2/250 (1%)


  Fly     4 IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAK 68
            ||||||||||||||:||:||||||||||||||||:||||.:|||:|||||||:||.||||||.||
 Frog     3 IFTPTNQIRLTNVAVVRMKKGGKRFEIACYKNKVMSWRSGAEKDLDEVLQTHSVFMNVSKGQVAK 67

  Fly    69 KDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASI 133
            |::|.|:|...|.|||||:||||||||||||||.:.|:.....|...||..||||||:|||..::
 Frog    68 KEDLLKSFGTEDPTEICKQILSKGELQVSEKERSTQLEQMFRDIATIVADKCVNPETKRPYTVNL 132

  Fly   134 IEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANA 198
            ||:::||.|:|||..::|||..|:.||.||:.|.|||:.|:||.....|: |.||||.:..|...
 Frog   133 IERAMKDIHYSVKATKSTKQQALDVIKQLKETMQIERAHMRLRFILPAKD-GKKLKEKLKPLIKH 196

  Fly   199 VEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESEELF 252
            .|.|.:|: .|.:..|||||.:|.||||:|.||||||.||:|.||:|.|.:|.|
 Frog   197 TESENFDQ-ELEIVCLIDPGCFREIDELIRCETKGKGTLEVLSLKDVEEGDEKF 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 133/221 (60%)
SBDS 18..99 CDD:279511 63/81 (78%)
SBDS_C 110..227 CDD:286465 56/117 (48%)
sbdsNP_001004953.1 SBDS_C 1..>223 CDD:331463 136/222 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C208054206
eggNOG 1 0.900 E1_COG1500
Hieranoid 1 1.000
Homologene 1 1.000 H6438
Inparanoid 1 1.050 298 1.000 Inparanoid score I2527
OMA 1 1.010
OrthoDB 1 1.010 D1217666at2759
OrthoFinder 1 1.000 FOG0004541
OrthoInspector 1 1.000 T1060807
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1300
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.