DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and sbds

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_957415.1 Gene:sbds ZFINID:ZDB-GENE-040426-1116 Length:231 Species:Danio rerio

Alignment Length:230 Identity:139/231 (60%)
Similarity:175/231 (76%) Gaps:2/231 (1%)


  Fly    21 LKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAKKDELQKAFNKTDETEIC 85
            :||||||||||||||||:||||.:|||:||||||:|||.||||||.|||::|..||...|.||||
Zfish     1 MKKGGKRFEIACYKNKVMSWRSGAEKDLDEVLQTNTVFVNVSKGQVAKKEDLSNAFGTDDLTEIC 65

  Fly    86 KEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASIIEKSLKDAHFSVKMNRN 150
            |:||||||||||:|||||.|:.....|...||..||||||:|||..::||:::||.|||||.|::
Zfish    66 KQILSKGELQVSDKERQSQLEQMFRDIATIVAEKCVNPETKRPYTVNLIERAMKDIHFSVKANKS 130

  Fly   151 TKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANAVEHEEWDEATLHLTLLI 215
            |||..||.||.||:.:.|:|:.|:||.....|: |.:|||.:..|..|||:|::|: .|.:..||
Zfish   131 TKQQALEVIKQLKESIQIQRAHMRLRFVLPAKD-GKRLKEKLKPLIKAVENEDFDD-QLEMVCLI 193

  Fly   216 DPGQYRVIDELVRNETKGKGLLELLELKEVVESEE 250
            |||.:|.||||:|.||||||.||:|.||:|.|.:|
Zfish   194 DPGCFRDIDELIRCETKGKGTLEVLSLKDVEEGDE 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 126/210 (60%)
SBDS 18..99 CDD:279511 60/78 (77%)
SBDS_C 110..227 CDD:286465 58/117 (50%)
sbdsNP_957415.1 Sdo1 1..222 CDD:224417 136/223 (61%)
SBDS 1..79 CDD:279511 60/78 (77%)
SBDS_C 88..205 CDD:286465 58/119 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C208053840
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6438
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1217666at2759
OrthoFinder 1 1.000 FOG0004541
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127367
Panther 1 1.100 LDO PTHR10927
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.