DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8549 and sbds

DIOPT Version :9

Sequence 1:NP_001261482.1 Gene:CG8549 / 38749 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_957415.1 Gene:sbds / 394096 ZFINID:ZDB-GENE-040426-1116 Length:231 Species:Danio rerio


Alignment Length:230 Identity:139/230 - (60%)
Similarity:175/230 - (76%) Gaps:2/230 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAKKDELQKAFNKTDETEIC 85
            :||||||||||||||||:||||.:|||:||||||:|||.||||||.|||::|..||...|.||||
Zfish     1 MKKGGKRFEIACYKNKVMSWRSGAEKDLDEVLQTNTVFVNVSKGQVAKKEDLSNAFGTDDLTEIC 65

  Fly    86 KEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASIIEKSLKDAHFSVKMNRN 150
            |:||||||||||:|||||.|:.....|...||..||||||:|||..::||:::||.|||||.|::
Zfish    66 KQILSKGELQVSDKERQSQLEQMFRDIATIVAEKCVNPETKRPYTVNLIERAMKDIHFSVKANKS 130

  Fly   151 TKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANAVEHEEWDEATLHLTLLI 215
            |||..||.||.||:.:.|:|:.|:||.....|: |.:|||.:..|..|||:|::|: .|.:..||
Zfish   131 TKQQALEVIKQLKESIQIQRAHMRLRFVLPAKD-GKRLKEKLKPLIKAVENEDFDD-QLEMVCLI 193

  Fly   216 DPGQYRVIDELVRNETKGKGLLELLELKEVVESEE 250
            |||.:|.||||:|.||||||.||:|.||:|.|.:|
Zfish   194 DPGCFRDIDELIRCETKGKGTLEVLSLKDVEEGDE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 PTZ00448 4..>226 CDD:185627 122/204 (60%)
sbdsNP_957415.1 Sdo1 1..222 CDD:224417 135/222 (61%)
SBDS 1..79 CDD:279511 60/77 (78%)
SBDS_C 88..205 CDD:286465 57/118 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596562
Domainoid 1 1.000 145 1.000 Domainoid score I4531
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6438
Inparanoid 1 1.050 300 1.000 Inparanoid score I2669
OMA 1 1.010 - - QHG54247
OrthoDB 1 1.010 - - D1217666at2759
OrthoFinder 1 1.000 - - FOG0004811
OrthoInspector 1 1.000 - - oto41444
orthoMCL 1 0.900 - - OOG6_101125
Panther 1 1.100 - - LDO PTHR10927
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1300
SonicParanoid 1 1.000 - - X3393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.