DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8549 and Sbds

DIOPT Version :9

Sequence 1:NP_001261482.1 Gene:CG8549 / 38749 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001008290.1 Gene:Sbds / 288615 RGDID:1311043 Length:250 Species:Rattus norvegicus


Alignment Length:249 Identity:149/249 - (59%)
Similarity:186/249 - (74%) Gaps:2/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAK 68
            ||||||||||||||:||:|:||||||||||||||:.|||..|||:|||||||:||.||||||.||
  Rat     3 IFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAK 67

  Fly    69 KDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASI 133
            |::|..||...|:|||||:||:|||:|||:|||.:.|:.....|...||..||||||:|||...:
  Rat    68 KEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVIL 132

  Fly   134 IEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANA 198
            ||:::||.|:|||.|::|||..||.||.||:.|.|||:.|:||......| |.||||.:..|...
  Rat   133 IERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFLLPVNE-GKKLKEKLKPLMKV 196

  Fly   199 VEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESEELF 252
            ||.|::.: .|.:..|||||.:|.||||::.||||||.||:|.||:|.|.:|.|
  Rat   197 VESEDYSQ-QLEIVCLIDPGCFREIDELIKKETKGKGSLEVLSLKDVEEGDEKF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 PTZ00448 4..>226 CDD:185627 132/221 (60%)
SbdsNP_001008290.1 PTZ00448 1..>223 CDD:185627 132/221 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354283
Domainoid 1 1.000 139 1.000 Domainoid score I4692
eggNOG 1 0.900 - - E1_COG1500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6438
Inparanoid 1 1.050 292 1.000 Inparanoid score I2696
OMA 1 1.010 - - QHG54247
OrthoDB 1 1.010 - - D1217666at2759
OrthoFinder 1 1.000 - - FOG0004811
OrthoInspector 1 1.000 - - oto95622
orthoMCL 1 0.900 - - OOG6_101125
Panther 1 1.100 - - LDO PTHR10927
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3393
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.