DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and Sbds

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001008290.1 Gene:Sbds RGDID:1311043 Length:250 Species:Rattus norvegicus

Alignment Length:249 Identity:149/250 (60%)
Similarity:186/250 (74%) Gaps:2/250 (1%)


  Fly     4 IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAK 68
            ||||||||||||||:||:|:||||||||||||||:.|||..|||:|||||||:||.||||||.||
  Rat     3 IFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAK 67

  Fly    69 KDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASI 133
            |::|..||...|:|||||:||:|||:|||:|||.:.|:.....|...||..||||||:|||...:
  Rat    68 KEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVIL 132

  Fly   134 IEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLANA 198
            ||:::||.|:|||.|::|||..||.||.||:.|.|||:.|:||......| |.||||.:..|...
  Rat   133 IERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFLLPVNE-GKKLKEKLKPLMKV 196

  Fly   199 VEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESEELF 252
            ||.|::.: .|.:..|||||.:|.||||::.||||||.||:|.||:|.|.:|.|
  Rat   197 VESEDYSQ-QLEIVCLIDPGCFREIDELIKKETKGKGSLEVLSLKDVEEGDEKF 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 129/221 (58%)
SBDS 18..99 CDD:279511 58/81 (72%)
SBDS_C 110..227 CDD:286465 58/117 (50%)
SbdsNP_001008290.1 Sdo1 9..241 CDD:224417 139/234 (59%)
SBDS 17..98 CDD:279511 58/81 (72%)
SBDS_C 107..224 CDD:286465 58/119 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C208052914
eggNOG 1 0.900 E1_COG1500
Hieranoid 1 1.000
Homologene 1 1.000 H6438
Inparanoid 1 1.050 292 1.000 Inparanoid score I2644
OMA 1 1.010
OrthoDB 1 1.010 D1217666at2759
OrthoFinder 1 1.000 FOG0004541
OrthoInspector 1 1.000 T1088393
orthoMCL 1 0.900 OOG5_127367
Panther 1 1.100 LDO PTHR10927
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.