DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and sdo1

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_593869.1 Gene:sdo1 PomBaseID:SPAC4F8.03 Length:246 Species:Schizosaccharomyces pombe

Alignment Length:243 Identity:122/244 (50%)
Similarity:167/244 (68%) Gaps:4/244 (2%)


  Fly     4 IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKGQAAK 68
            |..|..|||||||::|:.||||||||:|||||||..||:..|.|:|||||.|.||.|||||..|.
pombe     3 ISQPVGQIRLTNVSVVKYKKGGKRFEVACYKNKVTEWRNKIETDLDEVLQIHNVFNNVSKGHVAS 67

  Fly    69 KDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPYPASI 133
            :.:|:|||...|..:|..|||.||:.||.||||...:.:....||:.|.|:|::|.::|||||||
pombe    68 RQDLKKAFGTDDIDKIILEILQKGDFQVGEKERHHQMSSTYRDIVSHVTAMCMDPNSKRPYPASI 132

  Fly   134 IEKSLKDAHFSVKMNRNTKQNTLEAIKIL--KDHMPIERSRMKLRVSFAGKEGGGKLKESVVKLA 196
            |||:|.|..|||..::..|...|||||.|  |:.:||.|:||::|:....|:|.. |:|.:..||
pombe   133 IEKALSDCGFSVSTSKTAKSQALEAIKKLQEKNEIPIVRARMRIRIVVDVKQGKA-LRERLRSLA 196

  Fly   197 NAVEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKE 244
            :.:|.|..|:....:.|:| ||.|::||||||||||.:|::::|::.|
pombe   197 DEIEEENIDDEYECIALVI-PGNYKLIDELVRNETKNRGMVQVLDMSE 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 115/223 (52%)
SBDS 18..99 CDD:279511 48/81 (59%)
SBDS_C 110..227 CDD:286465 53/119 (45%)
sdo1NP_593869.1 Sdo1 9..245 CDD:224417 120/238 (50%)
SBDS 17..98 CDD:279511 48/81 (59%)
SBDS_C 108..226 CDD:286465 53/120 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6438
Inparanoid 1 1.050 235 1.000 Inparanoid score I827
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004541
OrthoInspector 1 1.000 T1125606
orthoMCL 1 0.900 OOG5_127367
Panther 1 1.100 LDO PTHR10927
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1300
TreeFam 1 0.960
1010.050

Return to query results.
Submit another query.