DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and SPBC21C3.19

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_596599.1 Gene:SPBC21C3.19 PomBaseID:SPBC21C3.19 Length:106 Species:Schizosaccharomyces pombe

Alignment Length:64 Identity:17/65 (26%)
Similarity:34/65 (52%) Gaps:6/65 (9%)


  Fly    37 VLSWRSNSEKDIDEVLQTHTVFTNV----SKGQ--AAKKDELQKAFNKTDETEICKEILSKGEL 94
            |:.||.:....:.|::.:..|||..    ::||  .|.|.||:..|..:.:.::..:||:.|::
pombe    30 VMRWRKDKTVPLTEIVDSFQVFTTSNNKGNEGQLITASKQELENTFGTSKDVDVVTKILTDGKI 93

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 17/65 (26%)
SBDS 18..99 CDD:279511 17/65 (26%)
SBDS_C 110..227 CDD:286465
SPBC21C3.19NP_596599.1 SBDS 11..93 CDD:279511 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10927
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.