DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8549 and sbds-1

Sequence 1:NP_001261482.1 Gene:CG8549 FlyBaseID:FBgn0035714 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_497226.2 Gene:sbds-1 WormBaseID:WBGene00021063 Length:253 Species:Caenorhabditis elegans

Alignment Length:253 Identity:146/254 (57%)
Similarity:190/254 (75%) Gaps:8/254 (3%)


  Fly     1 MSK-IFTPTNQIRLTNVAIVRLKKGGKRFEIACYKNKVLSWRSNSEKDIDEVLQTHTVFTNVSKG 64
            ||| |.|||||..|||||:||:||.|||||||||||||::||:.|||||||||||||||:|||||
 Worm     1 MSKNIKTPTNQKVLTNVAVVRMKKTGKRFEIACYKNKVVNWRNKSEKDIDEVLQTHTVFSNVSKG 65

  Fly    65 QAAKKDELQKAFNKTDETEICKEILSKGELQVSEKERQSCLDTQLNSIVNSVAALCVNPETRRPY 129
            |.:||:||..||...|:.||||.||.||:|||||||||:..|..|..:...:|::.|||||:||.
 Worm    66 QLSKKEELIAAFGIEDQLEICKIILDKGDLQVSEKERQAASDQSLKEVSQLIASMVVNPETKRPV 130

  Fly   130 PASIIEKSLKDAHFSVKMNRNTKQNTLEAIKILKDHMPIERSRMKLRVSFAGKEGGG---KLKES 191
            |.|:|:|:|::.|||:|.||::||..|:||..|::.:.|||::||:||:...||...   |||  
 Worm   131 PPSVIDKALQEMHFSLKPNRSSKQQALDAIPKLRETLKIERAKMKIRVAIPTKEAKSVHTKLK-- 193

  Fly   192 VVKLANAVEHEEWDEATLHLTLLIDPGQYRVIDELVRNETKGKGLLELLELKEVVESE 249
              .|.:.||.::|.:.:|.:..||:||.:|.:|:||||||||.|.||:|.||:|||.|
 Worm   194 --TLFSDVEVDDWQDGSLEMVGLIEPGSFRALDDLVRNETKGHGRLEILSLKDVVEGE 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8549NP_001261482.1 Sdo1 10..231 CDD:224417 125/224 (56%)
SBDS 18..99 CDD:279511 60/81 (74%)
SBDS_C 110..227 CDD:286465 49/120 (41%)
sbds-1NP_497226.2 Sdo1 11..244 CDD:224417 134/237 (57%)
SBDS 19..100 CDD:279511 60/81 (74%)
SBDS_C 111..227 CDD:286465 49/120 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C208049621
eggNOG 1 0.900 E1_COG1500
Hieranoid 1 1.000
Homologene 1 1.000 H6438
Inparanoid 1 1.050 278 1.000 Inparanoid score I1749
Isobase 1 0.950 0 Normalized mean entropy S584
OMA 1 1.010
OrthoDB 1 1.010 D1217666at2759
OrthoFinder 1 1.000 FOG0004541
OrthoInspector 1 1.000 T477274
orthoMCL 1 0.900 OOG5_127367
Panther 1 1.100 LDO PTHR10927
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1300
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.