DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF4E4 and Eif4e1b

Sequence 1:NP_648052.1 Gene:eIF4E4 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_017443170.1 Gene:Eif4e1b RGDID:1585494 Length:269 Species:Rattus norvegicus

Alignment Length:232 Identity:96/233 (41%)
Similarity:143/233 (61%) Gaps:9/233 (4%)


  Fly     5 QQTEFKMMDNGTETLADSPSSSSED----LKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLEN 65
            ::.|.::.:..:|..|:.....:.|    |||:.....|:..|::.  |..|||:..|.||:.:|
  Rat    40 EEEEEEVKEKPSEATAEGLQGEARDLPGSLKTVKQKAQREHPTKLP--RELHPLQFRWVLWFFKN 102

  Fly    66 DRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVI 130
            |||:.|:|....:|.||.|||||:.|.|:|..|::..|.||:|||:||||||||..||.||||::
  Rat   103 DRSRAWQDNLQLVTKFDTVEDFWATYRHVKLASKLSCGCDYALFKEGIQPMWEDSRNKRGGRWLL 167

  Fly   131 NMGRGSK-AELDKLWLDVLLILIGEAFEN-TEEVCGAVINLRGKSNKISIWTANGHNELAVMEIG 193
            ::.:..: .|||:|||:.||.|:||:||. :.||||||:|:|.|.:||::||:...|:..||.||
  Rat   168 SLAKQQRHMELDRLWLETLLCLLGESFEEYSGEVCGAVVNIRTKGDKIALWTSEAENKAGVMHIG 232

  Fly   194 LKLRDLLVLPPHQ-LQYQLHKDTMCKQGSVIKAVYCV 229
            ...::.|.|.... :.||.|.||..|..|:.|..:.|
  Rat   233 HIYKERLGLSTKTIIGYQAHADTAAKSNSLAKNKFVV 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 74/156 (47%)
Eif4e1bXP_017443170.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1394271at2759
OrthoFinder 1 1.000 FOG0000440
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.