DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF4E4 and eif4eb

Sequence 1:NP_648052.1 Gene:eIF4E4 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001007778.1 Gene:eif4eb ZFINID:ZDB-GENE-041121-14 Length:216 Species:Danio rerio

Alignment Length:231 Identity:101/232 (44%)
Similarity:142/232 (61%) Gaps:18/232 (8%)


  Fly     2 LTTQQTEFKMMDNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLEND 66
            :.|.:.|.|          .:...|.|::...|:.:|..|.:.|     ||||:|.|.||:.:||
Zfish     1 MATAEPEIK----------SNSCKSEEEISDESNQEIVSPESYI-----KHPLQNRWCLWFFKND 50

  Fly    67 RSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVIN 131
            :||.|:.....|:.||.|||||:|||||:..|.:..|.||||||.||:|||||:.||.||||:|.
Zfish    51 KSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLIT 115

  Fly   132 MGRGS-KAELDKLWLDVLLILIGEAFEN-TEEVCGAVINLRGKSNKISIWTANGHNELAVMEIGL 194
            :.:.. |.:||:.||:.||.||||||:: :::|||||:|:|.|.:||:||||:..|..||..||.
Zfish   116 LNKQQRKYDLDRFWLETLLCLIGEAFDDYSDDVCGAVVNVRTKGDKIAIWTADYGNREAVTHIGR 180

  Fly   195 KLRDLLVLPPHQ-LQYQLHKDTMCKQGSVIKAVYCV 229
            ..::.|.:|.:. :.||.|.||..|.||..|..:.|
Zfish   181 VYKERLGVPMNMTIGYQSHADTATKSGSTTKNKFVV 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 78/156 (50%)
eif4ebNP_001007778.1 IF4E 40..196 CDD:279921 78/156 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106096991
eggNOG 1 0.900 E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H123817
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1394271at2759
OrthoFinder 1 1.000 FOG0000440
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127278
Panther 1 1.100 O PTHR11960
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.