DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eif4eb

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001007778.1 Gene:eif4eb / 493617 ZFINID:ZDB-GENE-041121-14 Length:216 Species:Danio rerio


Alignment Length:231 Identity:101/231 - (43%)
Similarity:142/231 - (61%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LTTQQTEFKMMDNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLEND 66
            :.|.:.|.|          .:...|.|::...|:.:|..|.:.|     ||||:|.|.||:.:||
Zfish     1 MATAEPEIK----------SNSCKSEEEISDESNQEIVSPESYI-----KHPLQNRWCLWFFKND 50

  Fly    67 RSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVIN 131
            :||.|:.....|:.||.|||||:|||||:..|.:..|.||||||.||:|||||:.||.||||:|.
Zfish    51 KSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLIT 115

  Fly   132 MGRGS-KAELDKLWLDVLLILIGEAFEN-TEEVCGAVINLRGKSNKISIWTANGHNELAVMEIGL 194
            :.:.. |.:||:.||:.||.||||||:: :::|||||:|:|.|.:||:||||:..|..||..||.
Zfish   116 LNKQQRKYDLDRFWLETLLCLIGEAFDDYSDDVCGAVVNVRTKGDKIAIWTADYGNREAVTHIGR 180

  Fly   195 KLRDLLVLPPHQ-LQYQLHKDTMCKQGSVIKAVYCV 229
            ..::.|.:|.:. :.||.|.||..|.||..|..:.|
Zfish   181 VYKERLGVPMNMTIGYQSHADTATKSGSTTKNKFVV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 78/155 (50%)
eif4ebNP_001007778.1 IF4E 40..196 CDD:279921 78/155 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573563
Domainoid 1 1.000 193 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 216 1.000 Inparanoid score I3585
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.