DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eIF4E6

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster


Alignment Length:178 Identity:84/178 - (47%)
Similarity:109/178 - (61%) Gaps:23/178 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTQQTEFKMMDNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDR 67
            |.:.:||||   ||       |..:..|.:|...:             ||.|:||||||.::.|.
  Fly     7 TKESSEFKM---GT-------SLDNNKLASLGATN-------------KHRLQNTWTLWGVKYDP 48

  Fly    68 SKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINM 132
            ..:||||..||.||:.|||||:||..|..||::..|.||.||||||:|||||..||.||||...:
  Fly    49 EISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKV 113

  Fly   133 GRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWT 180
            .:.|.|||||.||||||.:||||.::.:::|||.:.:|...||||:||
  Fly   114 DKRSTAELDKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWT 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 71/125 (57%)
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 71/125 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470287
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1318
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
109.900

Return to query results.
Submit another query.