DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF4E4 and eIF4E6

Sequence 1:NP_648052.1 Gene:eIF4E4 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001189306.1 Gene:eIF4E6 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster

Alignment Length:178 Identity:84/179 (47%)
Similarity:109/179 (61%) Gaps:23/179 (13%)


  Fly     3 TTQQTEFKMMDNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDR 67
            |.:.:||||   ||       |..:..|.:|...:             ||.|:||||||.::.|.
  Fly     7 TKESSEFKM---GT-------SLDNNKLASLGATN-------------KHRLQNTWTLWGVKYDP 48

  Fly    68 SKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINM 132
            ..:||||..||.||:.|||||:||..|..||::..|.||.||||||:|||||..||.||||...:
  Fly    49 EISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKV 113

  Fly   133 GRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWT 180
            .:.|.|||||.||||||.:||||.::.:::|||.:.:|...||||:||
  Fly   114 DKRSTAELDKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWT 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 71/126 (56%)
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 71/126 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5150027
eggNOG 1 0.900 E1_COG5053
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1129
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1394271at2759
OrthoFinder 1 1.000 FOG0000440
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11960
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.