DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF4E4 and tif45

Sequence 1:NP_648052.1 Gene:eIF4E4 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_594228.1 Gene:tif45 PomBaseID:SPAC16E8.15 Length:218 Species:Schizosaccharomyces pombe

Alignment Length:220 Identity:81/221 (37%)
Similarity:127/221 (57%) Gaps:16/221 (7%)


  Fly     6 QTEFKMMDNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYL-ENDRSK 69
            |||....::.||.....|...:  |:|:.|        :.::..|||||...||||:| ......
pombe     2 QTEQPPKESQTENTVSEPQEKA--LRTVFD--------DKINFNLKHPLARPWTLWFLMPPTPGL 56

  Fly    70 NWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVI-NMG 133
            .|.::|..|.:|:.||:||.::|:|...|.:.:.||||.|::|::|.|||..||.||:|.. |.|
pombe    57 EWNELQKNIITFNSVEEFWGIHNNINPASSLPIKSDYSFFREGVRPEWEDVHNKTGGKWAFQNKG 121

  Fly   134 RGSKAELDKLWLDVLLILIGEAFENT-EEVCGAVINLRGKSNKISIWTANGHNELAVMEIGLKLR 197
            ||..| ||::||..:|..|||..:.| :||.|.|||:|....::::||.:.:|...:||||.:.:
pombe   122 RGGNA-LDEMWLTTVLAAIGETLDPTGQEVMGVVINMRKGFYRLAVWTKSCNNREVLMEIGTRFK 185

  Fly   198 DLLVLPPHQ-LQYQLHKDTMCKQGS 221
            .:|.||..: :::..|:|: .|.||
pombe   186 QVLNLPRSETIEFSAHEDS-SKSGS 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 62/157 (39%)
tif45NP_594228.1 CDC33 1..218 CDD:227386 81/221 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1298
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000440
OrthoInspector 1 1.000 T133336
orthoMCL 1 0.900 OOG5_127278
Panther 1 1.100 O PTHR11960
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R595
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.