| Sequence 1: | NP_001356975.1 | Gene: | axed / 38741 | FlyBaseID: | FBgn0035708 | Length: | 582 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001374496.1 | Gene: | BTBD6 / 90135 | HGNCID: | 19897 | Length: | 538 | Species: | Homo sapiens | 
| Alignment Length: | 345 | Identity: | 80/345 - (23%) | 
|---|---|---|---|
| Similarity: | 123/345 - (35%) | Gaps: | 93/345 - (26%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   121 SAPAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSV---- 181 
  Fly   182 -ELAKLIH---AGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSDRFN 242 
  Fly   243 VPDLIIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAA 307 
  Fly   308 KQL--AAAKASQS-TENGAEGDGA-----QQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAELQL 364 
  Fly   365 SMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLCLTP 429 
  Fly   430 RYLRMTASEFRRCCERLELL 449 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| axed | NP_001356975.1 | BTB | <192..258 | CDD:197585 | 10/65 (15%) | 
| BACK | <354..423 | CDD:355779 | 23/68 (34%) | ||
| BTBD6 | NP_001374496.1 | BTB_POZ_BTBD6 | 128..236 | CDD:349658 | 28/151 (19%) | 
| BACK_BTBD6 | 236..330 | CDD:350600 | 29/104 (28%) | ||
| PHR | 392..537 | CDD:400388 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2075 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45774 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||