DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and BTBD6

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_005268245.1 Gene:BTBD6 HGNCID:19897 Length:538 Species:Homo sapiens

Alignment Length:345 Identity:80/346 (23%)
Similarity:123/346 (36%) Gaps:93/346 (27%)


  Fly   121 SAPAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSV---- 181
            |||||:.||....||....                      |..:....||.|.::.||:.    
Human    89 SAPAPAPPPPAPAPPTLGN----------------------NHQESPGWRCCRPTLRERNALMFN 131

  Fly   182 -ELAKLIH---AGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSDRFN 242
             ||...:|   ..|.:.|....|..:|.|..:.|         :.:.|.|      :.|:....:
Human   132 NELMADVHFVVGPPGATRTVPAHKYVLAVGSSVF---------YAMFYGD------LAEVKSEIH 181

  Fly   243 VPDLIIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAA 307
            :||            :..|..|.:.|.::..:   :..:..||:.|              ..||.
Human   182 IPD------------VEPAAFLILLKYMYSDE---IDLEADTVLAT--------------LYAAK 217

  Fly   308 KQL--AAAKASQS-TENGAEGDGA-----QQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAELQL 364
            |.:  |.|||..: .|...|...|     |..|...|.          |.....::||..||:.|
Human   218 KYIVPALAKACVNFLETSLEAKNACVLLSQSRLFEEPE----------LTQRCWEVIDAQAEMAL 272

  Fly   365 SMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLCLTP 429
            ......::..:.||.:|.|:.|..: |..:||.:..|:.|||.|:.:..||.|:|.|||......
Human   273 RSEGFCEIDRQTLEIIVTREALNTK-EAVVFEAVLNWAEAECKRQGLPITPRNKRHVLGRALYLV 336

  Fly   430 RYLRMTASEFRRCCERLELL 449
            |...||..||.....:.::|
Human   337 RIPTMTLEEFANGAAQSDIL 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
BTBD6XP_005268245.1 BTB 129..232 CDD:279045 27/147 (18%)
BTB 137..236 CDD:197585 26/143 (18%)
BACK 242..348 CDD:197943 34/117 (29%)
PHR 393..536 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.