DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and Btbd1

DIOPT Version :10

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_666305.2 Gene:Btbd1 / 83962 MGIID:1933765 Length:488 Species:Mus musculus


Alignment Length:221 Identity:56/221 - (25%)
Similarity:81/221 - (36%) Gaps:57/221 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 QTVITTQETGQQLARKKATKAKAA------AKQLAAAKASQSTENGAEGDGAQQNLIPNPNPFTT 341
            :||:||..|    |:|.|..|..|      .|.|.|..|....        .|..|...|.    
Mouse   152 ETVMTTLYT----AKKYAVPALEAHCVEFLTKHLRADNAFMLL--------TQARLFDEPQ---- 200

  Fly   342 EDYGVALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAEC 406
                  |....|..||......:|....:|:..:.|..:::||||.:| |..||..:..|:.|||
Mouse   201 ------LASLCLDTIDKSTVDAISAEGFTDIDIDTLCAVLERDTLSIR-ESRLFGAIVRWAEAEC 258

  Fly   407 ARKHIDATPENRRTVLGPLCLTPRYLRMTASEFRRCCERLELLPPTEISLITDALDGKKLKNLTD 471
            .|:.:..|..|::.|||......|:..||..||        ...|.:..:::|            
Mouse   259 QRQQLAVTFGNKQKVLGKALSLIRFPLMTIEEF--------AAGPAQSGILSD------------ 303

  Fly   472 QQAELLEKF------RQPRAEYARMP 491
              .|::..|      .:||.||...|
Mouse   304 --REVVNLFLHFTVNPKPRVEYIDRP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BACK <354..423 CDD:475122 21/68 (31%)
Btbd1NP_666305.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
BTB_POZ_BTBD1 53..185 CDD:349655 13/36 (36%)
BACK 181..287 CDD:475122 32/124 (26%)
PHR 339..487 CDD:462339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.