DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and btbd6

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001072310.2 Gene:btbd6 XenbaseID:XB-GENE-6258082 Length:529 Species:Xenopus tropicalis

Alignment Length:443 Identity:94/444 (21%)
Similarity:144/444 (32%) Gaps:165/444 (37%)


  Fly    80 QITGPEDNQHQQNNNN---NDW--------EPNRMVLPFGLGPDGHHVDAIQSAPAPSAPPAHMM 133
            |...|....|..||||   .:|        |.|.::....|..|.|.:  :..|.|....|||. 
 Frog    85 QAAPPPPQLHNLNNNNIESGNWQSFHPTLRERNALMFNNELMADVHFI--VGPAGASKKVPAHK- 146

  Fly   134 PPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSVELAKLIHAGPNSGRKSD 198
                       |.   :.|...:.:.:..||                  ||::         ||:
 Frog   147 -----------YI---LAVGSSVFYAMFYGD------------------LAEV---------KSE 170

  Fly   199 NHFQILNVDKNDFELIVRYMEKHFIPYRDHKHL-----LKILELSDRFNVPDLIIYCIRELDLRI 258
            .|  |.:|:...|.::::|:      |.|...|     |..|..:.::.||.|...|:..|:   
 Frog   171 IH--IPDVEPAAFLILLKYL------YSDEIDLEADTVLATLYAAKKYIVPALAKACVNFLE--- 224

  Fly   259 SSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQLAAAKASQSTENGA 323
               |:|:                                     ||.|...|             
 Frog   225 ---TSLE-------------------------------------AKNACVLL------------- 236

  Fly   324 EGDGAQQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQL 388
                :|..|...|:          |.....::||..|||.|......::..:.||.:|.|:||..
 Frog   237 ----SQSRLFEEPD----------LTLRCWEVIDAQAELALKSEGFCEIDLQTLEIIVTRETLNT 287

  Fly   389 RSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLCLTPRYLRMTASEFRRCCERLELL---- 449
            :.:| :||.:..|:.|||.|:.:..||.|:|.|||......|...||..||.....:.::|    
 Frog   288 KEDV-VFEAVLNWAEAECKRQGLSITPVNKRNVLGKALYLVRIPTMTLEEFANGAAQSDILTLEE 351

  Fly   450 -------------PPTEISLITDALDGKKLKNLTDQQAELLEK--FRQPRAEY 487
                         |..|..||       |.|.|..|:....:.  :|..:..|
 Frog   352 TRSIFLWYTAANKPQLEFPLI-------KRKGLAPQRCHRFQSSAYRSNQWRY 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
btbd6NP_001072310.2 BTB 120..223 CDD:279045 30/155 (19%)
BTB 128..227 CDD:197585 31/157 (20%)
BACK 233..339 CDD:197943 37/134 (28%)
PHR 384..527 CDD:285277 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.