DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and btbd3a

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001139053.1 Gene:btbd3a ZFINID:ZDB-GENE-090312-7 Length:461 Species:Danio rerio

Alignment Length:474 Identity:105/475 (22%)
Similarity:163/475 (34%) Gaps:138/475 (29%)


  Fly   172 ERKSVLERSVELAKLIH--AGPNSG-RKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLK 233
            ||.||:..: ||...||  .||..| ::...|..:|.|..:.|         |.:.|.:      
Zfish    47 ERNSVMFNN-ELMADIHFVVGPPGGTQRVPGHKYVLAVGSSVF---------HAMFYGE------ 95

  Fly   234 ILELSDRFNVPDL----------IIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITT 288
            :.|..|...:||:          .||| .|:||..                        .||:.|
Zfish    96 LAEDKDEIRIPDVEPPSFLAMLKYIYC-DEIDLCA------------------------DTVLAT 135

  Fly   289 QETGQQLARKKATKAKAAAKQLAAAKASQSTENGAEGDGAQQN---LIPNPNPFTTEDYGVALLH 350
                           ..|||:......:::..|..|...:.:|   |:.....|...|    |..
Zfish   136 ---------------LYAAKKYIVPHLARACVNFLETSLSARNACVLLSQSCLFEEPD----LTQ 181

  Fly   351 NTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATP 415
            ...::||..|||.|......|:..:.||::::|:||..: |:.:||...:|:.|||.|:.:..|.
Zfish   182 RCWEVIDAQAELALRSEGFCDIDTQTLESILRRETLNAK-EMVVFEATLSWAEAECHRQELQPTI 245

  Fly   416 ENRRTVLGPLCLTPRYLRMTASEFRRCCER---LELLPPTEISLITDALDGKKL-------KNLT 470
            ||:|.|||......|...|...:|.....:   |.|....:|.|...|....:|       |.||
Zfish   246 ENKRLVLGKSIYLIRIPAMALDDFANGVAQSGVLTLNETNDIFLWYTAAKKPELKFVCKPRKGLT 310

  Fly   471 DQQAELLEK--FRQPRAEY-----------------ARMPVHLSDRSSPKNYPKKMRLAHEG--- 513
            .|:....:.  :|..:..|                 |...::.|...|.: |..|:.|..:|   
Zfish   311 PQKCHRFQSCAYRSNQWRYRGRCDSIQFAVDKRVFIAGFGLYGSSCGSAE-YQAKIELKRQGVTL 374

  Fly   514 -----RPTEDGCWEKVGMNCLRIFV---------CIFDXSEQSDGEE-EEEEEDGDDEEE----- 558
                 :...||     ..|...:|.         ..:. |...||.| ....::|..|.:     
Zfish   375 GIAIIKYFSDG-----SSNTFSVFFEYPVQIEPDTFYTASVILDGNELSYFGQEGMTEVQCGKVT 434

  Fly   559 ---DDGSDEENGNGNRAGR 574
               ...||..||.|.:.|:
Zfish   435 FQFQCSSDSTNGTGVQGGQ 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
btbd3aNP_001139053.1 BTB 52..155 CDD:279045 30/159 (19%)
BTB 60..159 CDD:197585 29/154 (19%)
BACK 165..271 CDD:197943 34/111 (31%)
PHR 316..459 CDD:285277 25/145 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.