DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: axed and btbd6b

Sequence 1:NP_001356975.1 Gene:axed FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_005160551.1 Gene:btbd6b ZFINID:ZDB-GENE-030829-65 Length:535 Species:Danio rerio

Alignment Length:500 Identity:103/500 (21%)
Similarity:159/500 (32%) Gaps:194/500 (39%)


  Fly    52 KRITKFPLVGALVHKALRRREEAE---------------------DEK--VQ----ITGPEDNQH 89
            |:::|.|:...:|..:||::..||                     .:|  ||    :|.|.....
Zfish    34 KQLSKLPVCYEIVTLSLRKKMAAELYPASINTNLPNSNSTAVTAASKKTIVQVTQTVTTPTTTAT 98

  Fly    90 QQNNNNND-----W--------EPNRMVLPFGLGPDGHHVDAIQSAPAPSAPPAHMMPPAYARGQ 141
            |||.|||:     |        |.|.::....|..|.|.|  :....|....|||          
Zfish    99 QQNINNNNVETASWQSTHPTLRERNALMFNNELMADVHFV--VGPPGASQKVPAH---------- 151

  Fly   142 TNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSVELAKLIHAGPNSGRKSDNHFQILNV 206
                                            |.||.....:...:..|..:..:|:.|  |.:|
Zfish   152 --------------------------------KYVLAVGSSVFGAMFYGDLAEGESEIH--IPDV 182

  Fly   207 DKNDFELIVRYMEKHFIPYRDHKHL-----LKILELSDRFNVPDLIIYCIRELDLRISSATALDI 266
            :...|.::::||      |.|...|     |..|..:.::.||.|...|:..|:      |:|: 
Zfish   183 EPAAFLILLKYM------YSDEIELEADTVLATLYAAKKYIVPALAKACVTFLE------TSLE- 234

  Fly   267 FKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQLAAAKASQSTENGAEGDGAQQN 331
                                                ||.|...|                 :|..
Zfish   235 ------------------------------------AKNACVLL-----------------SQSR 246

  Fly   332 LIPNPNPFTTEDYGVALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFE 396
            |...|.          |.....::||..|||.|......::..:.||.::||:||..| |..:|:
Zfish   247 LFEEPE----------LTLRCWEVIDAQAELALHSEGFCEIDLQTLEIILKRETLNTR-EAVVFQ 300

  Fly   397 CLATWSLAECARKHIDATPENRRTVLGPLCLTPRYLRMTASEFRRCCERLELL------------ 449
            ....|::|||.|:.:..|..|:|.|||......|...||..||.....:.::|            
Zfish   301 AALDWAVAECKRQGLGPTARNKRAVLGKALYLVRIPTMTLEEFANGAAQSDVLTLEETHDVFLWY 365

  Fly   450 -----PPTEISLITDALDGKKLKNLTDQQAELLEK--FRQPRAEY 487
                 |..|..|       :|.|.||.|:....:.  :|..:..|
Zfish   366 TAANKPKLEFPL-------QKRKGLTPQRCHRFQSSAYRSNQWRY 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 None
btbd6bXP_005160551.1 BTB 126..229 CDD:279045 28/155 (18%)
BTB 134..233 CDD:197585 29/157 (18%)
BACK 239..345 CDD:197943 36/134 (27%)
PHR 390..533 CDD:285277 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.